Clone Name | rbastl21h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRI37_HUMAN (O94972) Tripartite motif protein 37 (Mulibrey nanis... | 28 | 5.4 |
---|
>TRI37_HUMAN (O94972) Tripartite motif protein 37 (Mulibrey nanism protein)| Length = 964 Score = 28.5 bits (62), Expect = 5.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 14 IKFQAQHPTLLSYSTSKHWQVTTDNSSSTKKLQ 112 ++FQ + PT S +HW +T ++ T +Q Sbjct: 399 LRFQVRSPTFFQKSRDQHWYITQLEAAQTSYIQ 431 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,405,736 Number of Sequences: 219361 Number of extensions: 334152 Number of successful extensions: 644 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)