Clone Name | rbastl21c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SAK1_SCHPO (P48383) Protein sak1 | 30 | 3.5 | 2 | JHD1_EMENI (Q5AW75) JmjC domain-containing histone demethylation... | 29 | 5.9 |
---|
>SAK1_SCHPO (P48383) Protein sak1| Length = 766 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 157 RRSFPSIKSRKISSTCYYIVMYGSDERSGSDAISRVRADADRP-TDISCSTF 309 R FPSIK+R++ + Y + G D+ R+R +D + +SCS+F Sbjct: 148 RLLFPSIKTRRLGMRGHSKYHYCGIKLRGQDSFRRLRTFSDSSLSPVSCSSF 199
>JHD1_EMENI (Q5AW75) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1407 Score = 28.9 bits (63), Expect = 5.9 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 56 PNLTATLKTRAASMLHQA*QKADH----PTNSLTCSLTGVVSLRSNHGRSAALVTTLSCM 223 P TA +T AS A +DH PT+ S RS HGRS++ + TL+ + Sbjct: 33 PCSTADYRTYRASREISASATSDHVRSTPTDKRPSPADVPASHRSGHGRSSSTIDTLATI 92 Query: 224 A 226 A Sbjct: 93 A 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.130 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,346,845 Number of Sequences: 219361 Number of extensions: 751032 Number of successful extensions: 1833 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1832 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)