Clone Name | rbastl21b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YGB5_YEAST (P33199) Hypothetical 15.0 kDa protein in PDR6-PDR1 i... | 28 | 4.3 | 2 | K6PF2_SYNY3 (Q55988) 6-phosphofructokinase 2 (EC 2.7.1.11) (Phos... | 28 | 5.6 | 3 | Y1067_METMP (Q6LYC4) Putative iron-sulfur protein MMP1067 | 27 | 9.6 | 4 | Y092_METJA (Q57557) Putative iron-sulfur protein MJ0092 | 27 | 9.6 |
---|
>YGB5_YEAST (P33199) Hypothetical 15.0 kDa protein in PDR6-PDR1 intergenic| region Length = 130 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 8 DISSTCFQNLASHDKLSAHYFLDPASNTI 94 D+ S CF N D LS + FL P S+ + Sbjct: 72 DVDSLCFSNCFQPDALSGNVFLPPRSSNM 100
>K6PF2_SYNY3 (Q55988) 6-phosphofructokinase 2 (EC 2.7.1.11) (Phosphofructokinase| 2) (Phosphohexokinase 2) Length = 384 Score = 28.1 bits (61), Expect = 5.6 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -3 Query: 255 LLQAFASEDGQYAVKMLLSGGL-IVVIPRITPCLSL*L---AVLLFVTVRRSGLMSLSIV 88 ++Q + G + ++GG I++IP ITPCL+ + + +R+SG IV Sbjct: 184 IVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFALIV 243 Query: 87 LDAG 76 + G Sbjct: 244 ISEG 247
>Y1067_METMP (Q6LYC4) Putative iron-sulfur protein MMP1067| Length = 494 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 279 QVAFNAGKLLQAFASEDGQYAVKMLLSGGLIVVIPRITPC 160 +VAF G L+ E G+ A+++L + G+ V+IP+ C Sbjct: 264 RVAFFTGCLVDFRLQEIGKSAIRVLNAHGVSVIIPKNQVC 303
>Y092_METJA (Q57557) Putative iron-sulfur protein MJ0092| Length = 489 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 303 HEAPKVQAQVAFNAGKLLQAFASEDGQYAVKMLLSGGLIVVIPRITPC 160 + A + +VAF G L+ G+ A+K+L + G+ VVIP+ C Sbjct: 253 YPAESEKLRVAFFTGCLVDFRLQNVGKDAIKVLNAHGVSVVIPKNQVC 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,514,940 Number of Sequences: 219361 Number of extensions: 952900 Number of successful extensions: 2459 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2459 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)