Clone Name | rbastl21b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MKS1_YEAST (P34072) Negative regulator of RAS-cAMP pathway | 29 | 4.2 | 2 | TGM5_HUMAN (O43548) Protein-glutamine gamma-glutamyltransferase ... | 29 | 5.5 | 3 | PUR4_HUMAN (O15067) Phosphoribosylformylglycinamidine synthase (... | 29 | 5.5 | 4 | DCR1B_HUMAN (Q9H816) DNA cross-link repair 1B protein (hSNM1B) | 29 | 5.5 |
---|
>MKS1_YEAST (P34072) Negative regulator of RAS-cAMP pathway| Length = 584 Score = 29.3 bits (64), Expect = 4.2 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 9/87 (10%) Frame = +1 Query: 79 PKDHNIKPSSHRPNTKTQSIV-IEAMNMPESLNNAHILVRM--------ETGHIYHSLAP 231 P + IK +P+ KT ++ + +++ P+ NN + + + E+ H+Y S AP Sbjct: 418 PSANGIK--QQKPSLKTSNVTALASLSPPQPSNNERLSMDIQKDFKTDNESNHLYESNAP 475 Query: 232 LSAVCFPFLELQACIYPTATPIYFHLP 312 L+A I PTA + LP Sbjct: 476 LTA---------QTILPTALSTHMFLP 493
>TGM5_HUMAN (O43548) Protein-glutamine gamma-glutamyltransferase 5 (EC| 2.3.2.13) (Transglutaminase-5) (TGase 5) (Transglutaminase X) (TGase X) (TGX) (TG(X)) Length = 719 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 272 AFILQLPPSISTFLASSSYSQHTKYSTSEQLVR 370 AFI P T+ SYSQ+++Y ++++L+R Sbjct: 562 AFITLSPKEAKTYPCKISYSQYSQYLSTDKLIR 594
>PUR4_HUMAN (O15067) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1338 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 93 IVVLGVGRLSIRKERKDIGLLLLSW 19 I +LG GRL++ K +++GL L SW Sbjct: 174 INILGEGRLALEKANQELGLALDSW 198
>DCR1B_HUMAN (Q9H816) DNA cross-link repair 1B protein (hSNM1B)| Length = 532 Score = 28.9 bits (63), Expect = 5.5 Identities = 25/103 (24%), Positives = 41/103 (39%), Gaps = 8/103 (7%) Frame = +2 Query: 92 ISNPRRTDQIQKLS--------QLSSKL*TCQNL*TMHTSSSEWKQGTYTIALLPCQRFV 247 + +PRR + +Q L + + ++ ++ H++ W Q TIA+LP R + Sbjct: 202 VLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKI 261 Query: 248 SHFLSYKHAFILQLPPSISTFLASSSYSQHTKYSTSEQLVRAL 376 H I +P YS H+ YS V AL Sbjct: 262 HS----SHPDIHVIP-----------YSDHSSYSELRAFVAAL 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,501,571 Number of Sequences: 219361 Number of extensions: 1469322 Number of successful extensions: 3829 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3829 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)