Clone Name | rbastl21b09 |
---|---|
Clone Library Name | barley_pub |
>MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple resistance and| pH homeostasis protein D) (Mrp complex subunit D) Length = 493 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 81 NILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGKASVYP 212 ++L L++ L + + + H+FW E+E P+ + K +YP Sbjct: 408 SMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYP 451
>GLR27_ARATH (Q8LGN0) Glutamate receptor 2.7 precursor (Ligand-gated ion channel| 2.7) Length = 949 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 102 RSERIGCFLFYTSRGLSLFQKRKEKKNTWSFMK 4 RS + L YT G+S+ K+ KNTW F++ Sbjct: 544 RSLYVDFTLPYTESGVSMMVPLKDNKNTWVFLR 576
>ACA12_ARATH (Q9LY77) Putative calcium-transporting ATPase 12, plasma| membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 12) Length = 1033 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -3 Query: 120 WRHIVLRS-ERIGCFLFYTSRGLSLFQKRKEKKNTWSF 10 WR+++++S +I L +G+S+F RKE K+T F Sbjct: 883 WRNLLVQSLYQIAVLLILQFKGMSIFSVRKEVKDTLIF 920
>SYHH_HUMAN (P49590) Histidyl-tRNA synthetase homolog (EC 6.1.1.21)| (Histidine--tRNA ligase homolog) (HisRS) Length = 506 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 139 AIPSGKMKKKILKPLFSMEKHQSTHENSPQS*NLREKYLDLL 264 A+ + ++K KP F ++ + T + SPQ +REK LDL+ Sbjct: 40 AVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLV 81
>YDY2_SCHPO (O13683) Hypothetical protein C11E3.02c in chromosome I| Length = 1237 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -1 Query: 314 YHEEFG*LPQLSWDD*LSKSRYFSRKFQL 228 +H+ F L W+D L+ +R+F+R F++ Sbjct: 672 FHQAFRTLEGFEWEDDLANARFFTRFFRV 700
>ASPM_SHEEP (P62297) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3374 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/51 (23%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 142 WRVSRMVLEAHSSAFRKNRMFSFLYFSW----LILVSEKKGKKEYLVFHEK 2 W+++ ++++ H A+R ++ LY W +++ + KG K + EK Sbjct: 2422 WKLAXVLIQQHYRAYRAAKLQRALYIRWRHSAVVIQAAYKGLKARQLLREK 2472
>SSRP_CAMJR (Q5HTZ9) SsrA-binding protein| Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 78 ENILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGK 197 +N +F LN+ + ++L T HSF+++EE + H K Sbjct: 50 KNEIFLLNSHI----SLLHTTHSFYKHEERGARKLLMHRK 85
>SSRP_CAMJE (Q9PNI9) SsrA-binding protein| Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 78 ENILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGK 197 +N +F LN+ + ++L T HSF+++EE + H K Sbjct: 50 KNEIFLLNSHI----SLLHTTHSFYKHEERGARKLLMHRK 85
>GATA_NEIMB (Q9JYZ9) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 481 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 13/53 (24%) Frame = -2 Query: 328 WRSSCTMKSLGNYLNSH-----------GMISL--ASQDIFPVNFSSVGSFHG 209 WRS+C K L N+++ + GM++L + D F + ++ SF+G Sbjct: 84 WRSACASKMLDNFISPYTATVVQNLLDEGMVTLGRTNMDEFAMGSTNENSFYG 136
>GATA_NEIMA (Q9JTZ5) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 481 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 13/53 (24%) Frame = -2 Query: 328 WRSSCTMKSLGNYLNSH-----------GMISL--ASQDIFPVNFSSVGSFHG 209 WRS+C K L N+++ + GM++L + D F + ++ SF+G Sbjct: 84 WRSACASKMLDNFISPYTATVVQKLLDEGMVTLGRTNMDEFAMGSTNENSFYG 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,668,058 Number of Sequences: 219361 Number of extensions: 983561 Number of successful extensions: 2748 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2737 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)