| Clone Name | rbastl21b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BUB1B_MOUSE (Q9Z1S0) Mitotic checkpoint serine/threonine-protein... | 30 | 1.6 | 2 | PDXJ_XANCP (Q8PEG8) Pyridoxal phosphate biosynthetic protein pdx... | 29 | 2.7 | 3 | PDXJ_XANC8 (Q4V0R7) Pyridoxal phosphate biosynthetic protein pdx... | 29 | 2.7 | 4 | SOCS4_HUMAN (Q8WXH5) Suppressor of cytokine signaling 4 (SOCS-4)... | 28 | 4.6 | 5 | ZN227_HUMAN (Q86WZ6) Zinc finger protein 227 | 28 | 7.9 |
|---|
>BUB1B_MOUSE (Q9Z1S0) Mitotic checkpoint serine/threonine-protein kinase BUB1 beta| (EC 2.7.11.1) (MAD3/BUB1-related protein kinase) (Mitotic checkpoint kinase MAD3L) Length = 1052 Score = 30.0 bits (66), Expect = 1.6 Identities = 10/42 (23%), Positives = 25/42 (59%) Frame = +3 Query: 45 IKIYWQGLSFSILMSLGILIKEKIWNRGWIQLIEAT*LDTIS 170 + ++W GL + + S L ++WN+ +++++ A+ T+S Sbjct: 959 LHVFWDGLLWKLSQSTSELKDSELWNKFFVRILNASDKSTVS 1000
>PDXJ_XANCP (Q8PEG8) Pyridoxal phosphate biosynthetic protein pdxJ (PNP| synthase) Length = 256 Score = 29.3 bits (64), Expect = 2.7 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 35 HDSNQNILAGFELFHPHV----IGHPYKGKNLEQRLDPAHRSHLA 157 HD +Q+ LA F P V IGH G+ L Q L+P R++LA Sbjct: 202 HDLSQHNLADFLAGVPDVLEVSIGHALVGEALYQGLEPTVRAYLA 246
>PDXJ_XANC8 (Q4V0R7) Pyridoxal phosphate biosynthetic protein pdxJ (PNP| synthase) Length = 256 Score = 29.3 bits (64), Expect = 2.7 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 35 HDSNQNILAGFELFHPHV----IGHPYKGKNLEQRLDPAHRSHLA 157 HD +Q+ LA F P V IGH G+ L Q L+P R++LA Sbjct: 202 HDLSQHNLADFLAGVPDVLEVSIGHALVGEALYQGLEPTVRAYLA 246
>SOCS4_HUMAN (Q8WXH5) Suppressor of cytokine signaling 4 (SOCS-4) (Suppressor of| cytokine signaling 7) (SOCS-7) Length = 440 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 14 KTDS*IRHDSNQNILAGFELFHPHVIGHPYKGKNLEQRLDPA 139 KT+ +R+ ++ + EL H GH + G++L+Q+L A Sbjct: 57 KTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDA 98
>ZN227_HUMAN (Q86WZ6) Zinc finger protein 227| Length = 799 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 255 WQAKESCGDTYKGQSEVLSPG 193 W+ + SCG+TY +S++ S G Sbjct: 172 WRTQHSCGNTYLSESQIQSRG 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,471,059 Number of Sequences: 219361 Number of extensions: 891517 Number of successful extensions: 1800 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1800 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)