| Clone Name | rbastl21b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SETX_HUMAN (Q7Z333) Probable helicase senataxin (EC 3.6.1.-) (SE... | 31 | 0.70 | 2 | YN25_YEAST (P53831) Hypothetical 14.1 kDa protein in SEC21-MRPL1... | 30 | 1.2 | 3 | GYRB_BUCAP (P29435) DNA gyrase subunit B (EC 5.99.1.3) | 30 | 1.6 | 4 | BACH2_MOUSE (P97303) Transcription regulator protein BACH2 (BTB ... | 28 | 7.7 |
|---|
>SETX_HUMAN (Q7Z333) Probable helicase senataxin (EC 3.6.1.-) (SEN1 homolog)| Length = 2677 Score = 31.2 bits (69), Expect = 0.70 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 14/82 (17%) Frame = +3 Query: 18 LQLPLLEMLKQYMLTLKEKEKERCRQRV----SGYCSIGVYRKLP----------NMAHN 155 L++PLLE+LK L L E+ E C + + CS V+ K P M Sbjct: 110 LRVPLLEILKYPYLLLHERVNELCVEALCRMEQANCSFQVFDKHPGIYLFLVHPNEMVRR 169 Query: 156 WVNVSLRLENITSQVDKFSLQE 221 W ++ R + D + LQE Sbjct: 170 WAILTARNLGKVDRDDYYDLQE 191
>YN25_YEAST (P53831) Hypothetical 14.1 kDa protein in SEC21-MRPL10 intergenic| region Length = 123 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 159 VNVSLRLENITSQVDKFSLQENKKVQTQLVKRNENSFLSRPSTG 290 +NV + LEN ++ + KF EN+ L ++N + +RP G Sbjct: 7 INVDIILENASNAIKKFERYENRTRVPTLEGWDDNHYTNRPCVG 50
>GYRB_BUCAP (P29435) DNA gyrase subunit B (EC 5.99.1.3)| Length = 803 Score = 30.0 bits (66), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +3 Query: 132 KLPNMAHNWVNVSLRLENITSQVDKFSLQENKKVQTQLVKRNENSFLSRPSTGCSR 299 K N+ NW+ E + +++K +N + T +KRNEN + PS SR Sbjct: 620 KNENVVQNWI------EKLVEKLNK--KDKNNTIYTSKIKRNENDSIFEPSIKLSR 667
>BACH2_MOUSE (P97303) Transcription regulator protein BACH2 (BTB and CNC homolog| 2) Length = 716 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 171 LRLENITSQVDKFSLQENKKVQTQLVKRNENSFLSRPSTGCSRP 302 LR+ N+ F +QTQL+ R + F+ R + C RP Sbjct: 116 LRMHNLEDSCFSF-------LQTQLLNREDGLFVCRKDSACQRP 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,301,788 Number of Sequences: 219361 Number of extensions: 723530 Number of successful extensions: 1796 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1796 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)