| Clone Name | rbastl21a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BDLF2_EBV (P03225) Protein BDLF2 | 34 | 0.15 | 2 | DPOL_RSIV (O70736) DNA polymerase (EC 2.7.7.7) | 30 | 2.9 | 3 | Y1792_ARCFU (O28482) Hypothetical protein AF1792 | 30 | 3.8 | 4 | TGM5_HUMAN (O43548) Protein-glutamine gamma-glutamyltransferase ... | 28 | 8.4 |
|---|
>BDLF2_EBV (P03225) Protein BDLF2| Length = 420 Score = 34.3 bits (77), Expect = 0.15 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Frame = -3 Query: 192 LEVYYIYLCCNVCDLLLATAGYNPRFVRKFTSISLYDL----NNLFWCLSGTRKHNPFCA 25 L +IY CC + L L G+NP F+ F + L + LS NPFC Sbjct: 187 LSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCPTNPFCK 246 Query: 24 IIFLLP 7 + L+P Sbjct: 247 VYTLIP 252
>DPOL_RSIV (O70736) DNA polymerase (EC 2.7.7.7)| Length = 947 Score = 30.0 bits (66), Expect = 2.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 186 VYYIYLCCNVCDLLLATAGYNP 121 +YY+ N CD LL TAGY P Sbjct: 899 LYYMKSVVNACDQLLVTAGYGP 920
>Y1792_ARCFU (O28482) Hypothetical protein AF1792| Length = 137 Score = 29.6 bits (65), Expect = 3.8 Identities = 20/57 (35%), Positives = 27/57 (47%) Frame = -3 Query: 399 EGFDRRNSNPVTIGALCASALIG*TVYHTENGQCVAAVVEPKCRLVLLVLIYGYYEF 229 E RR +IGA + A++ HTE + V C LVL ++ YGYY F Sbjct: 79 ERASRRTVEIFSIGAALSGAVMLALDLHTEAALALEFAV--CCVLVLYLIFYGYYSF 133
>TGM5_HUMAN (O43548) Protein-glutamine gamma-glutamyltransferase 5 (EC| 2.3.2.13) (Transglutaminase-5) (TGase 5) (Transglutaminase X) (TGase X) (TGX) (TG(X)) Length = 719 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 Query: 260 NTKRHLGSTTAATHWPFSVW*TVYPMRAEAHSAPIVTGFEFLRSNPSCLSIQAFC 424 NT R LG+ T W F VW + R + P G++ L + P +S +C Sbjct: 319 NTGRILGNKKKDTIWNFHVWNECWMARKDL--PPAYGGWQVLDATPQEMSNGVYC 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,511,210 Number of Sequences: 219361 Number of extensions: 1315607 Number of successful extensions: 2934 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2934 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)