Clone Name | rbastl21a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-ass... | 29 | 5.0 | 2 | SMI2_DEBHA (Q6BJY4) KNR4/SMI1 homolog 2 | 29 | 6.6 | 3 | UPPS_FRATT (Q5NHX6) Undecaprenyl pyrophosphate synthetase (EC 2.... | 29 | 6.6 |
---|
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 29.3 bits (64), Expect = 5.0 Identities = 20/70 (28%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = -3 Query: 233 CFSGLVLSFVYEFCCFP---DGLCCFFCSSGA*IGTNCYSSLAYQPDKSSFLQFGLISTS 63 C SG S CC P CC CS + G++C S Y+P Sbjct: 159 CSSGCGSSCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSSCYKP-------------- 204 Query: 62 **CCCLFWVC 33 CCC C Sbjct: 205 --CCCQSSCC 212
>SMI2_DEBHA (Q6BJY4) KNR4/SMI1 homolog 2| Length = 590 Score = 28.9 bits (63), Expect = 6.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 431 SNIQRMIFGHLRKLKLMNYVVETWAEKAATVDGARGKHDH 312 SN+Q +FG + L+L N+ ++ + +DG+R D+ Sbjct: 311 SNLQEFMFGFVSDLELGNFQIDQNDQDGGFLDGSRNDDDY 350
>UPPS_FRATT (Q5NHX6) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 257 Score = 28.9 bits (63), Expect = 6.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 455 DGKGGWSQSNIQRMIFGHLRKLKLMNYVVETWAE 354 DG G W++S ++ IFGH + ++ +E E Sbjct: 34 DGNGRWAKSRLKPRIFGHRNSVSSVDATIEYCVE 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,558,187 Number of Sequences: 219361 Number of extensions: 1056402 Number of successful extensions: 2736 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2736 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)