| Clone Name | rbastl20h02 |
|---|---|
| Clone Library Name | barley_pub |
>DOA_DROME (P49762) Serine/threonine-protein kinase Doa (EC 2.7.12.1) (Protein| darkener of apricot) Length = 832 Score = 29.3 bits (64), Expect = 2.3 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 4/100 (4%) Frame = +1 Query: 46 TGSAKSACMQSQLPAPTTRGKC*KETMFTTTNTLRQSTSWAHSKEVYTTQITLQLR*TDS 225 T S+ SA + Q KC + + T++ STS +++ + + +T + + + Sbjct: 10 TSSSSSAATKRQKDVDNKLEKCLNDMLKLKTSSNNNSTSNSNNNAIMSHSLTGEHKDPKT 69 Query: 226 A----TSVSATRPRLHVRKLQQGLPVPGARRVLVYRPQKP 333 A TS S++ ++ + Q +PVP V +Y PQKP Sbjct: 70 ALEGPTSSSSSSSSKYIGESQ--IPVP----VQLYDPQKP 103
>RFX1_HUMAN (P22670) MHC class II regulatory factor RFX1 (RFX) (Enhancer factor| C) (EF-C) Length = 979 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 220 DSATSVSATRP------RLHVRKLQQGLPVPGARRVLVYRPQKPRPG 342 +S++S +A P +L V +QQ +PV R V+ PQ P+PG Sbjct: 214 NSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPG 260
>IAP2_NPVOP (O10324) Probable apoptosis inhibitor 2 (IAP-2)| Length = 236 Score = 28.5 bits (62), Expect = 4.0 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 10/75 (13%) Frame = +2 Query: 173 AKRSTRHKLRYNCVKLI--LLRPSQLQDRGYT--------YASCSKAFQYLEHDGFWCIA 322 A+R RH CV I L+ L+ R + + S ++ L GF+C+ Sbjct: 59 ARRVKRHTYSDTCVSAINALVANESLRKRSFASFKWARRQFGSRAREVDMLSRRGFYCVG 118 Query: 323 LRSHAPGLCIVSTSC 367 R G C V T+C Sbjct: 119 KRLRCAG-CKVVTTC 132
>UL49_HCMVA (P16786) Hypothetical protein UL49 (HFLF5 protein)| Length = 570 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 19 HKVHKTKCQTGSAKSACMQSQLPAPTTRG 105 H + +CQTG + +C++S+ AP RG Sbjct: 504 HGLLCARCQTGEYRDSCLESEDGAPLCRG 532
>SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor| Length = 263 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 91 PTTRGKC*KETMFTTTNTLRQSTSWAHSKEVYTTQITLQLR*TDSATS 234 PTTR + T TTT T R +T+ ++ TT T + T + T+ Sbjct: 109 PTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPTTTTTTT 156
>PAG1_HUMAN (Q9NWQ8) Phosphoprotein associated with glycosphingolipid-enriched| microdomains 1 (Transmembrane adapter protein PAG) (Csk-binding protein) (Transmembrane phosphoprotein Cbp) Length = 432 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 28 HKTKCQTGSAKSACMQSQLPAPTTRGK 108 H K +G AKS +LP P T GK Sbjct: 195 HLEKGHSGKAKSTSASKELPGPQTEGK 221
>STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Protein| stubble-stubbloid) [Contains: Serine proteinase stubble non-catalytic chain; Serine proteinase stubble catalytic chain] Length = 787 Score = 27.7 bits (60), Expect = 6.8 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 19 HKVHKTKCQTGSAKSACMQSQLPAPTTRG-KC*KETMFTTTNTLRQSTSWAHSKEVYTTQ 195 H+ + + G++ +A S P+ TT T TTT T R +T ++ T + Sbjct: 381 HRPTRPQLSPGTSLAASSSSHWPSSTTSTTSSTTSTTTTTTTTRRTTTPTTTTRRTTTNK 440 Query: 196 ITLQLR*TDSATSVSAT 246 T + +ATS S+T Sbjct: 441 PTRPYQRPTTATSSSST 457
>EPCR_BOVIN (Q28105) Endothelial protein C receptor precursor (Endothelial cell| protein C receptor) (Activated protein C receptor) (APC receptor) Length = 241 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 405 TAVLAGPQQKKQQQLVETMQSPGAWLLRAIHQNPSCSRYWKALLQLAYV 259 T VL GP + Q ++ +Q P +W L I+ N RY + + L V Sbjct: 57 THVLEGPGRNVSIQQLQPLQEPDSWALTKIYLN----RYLEEFVGLVQV 101
>BNK_DROME (P40794) Protein bottleneck| Length = 303 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 151 QSTSWAHSKEVYTTQITLQLR*TDSATSVSATRPRLH 261 Q T + K +T+Q+ ++L T+ +S RP+LH Sbjct: 48 QPTITSTPKPRFTSQLAVELAKTEPGNGISPLRPKLH 84
>POLG_KUNJM (P14335) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3433 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 227 LRPSQLQDRGYTYASCSKAFQYL 295 ++ +LQ +G TY CSKAF++L Sbjct: 580 VKMEKLQLKGTTYGVCSKAFRFL 602
>VGNB_RCMV (P35930) Genome polyprotein B (RNA1 polyprotein) [Contains: Protease| cofactor (32 kDa protein); Putative helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein) (58 kDa protein); Viral genome-linked protein (VPg); Picornain Length = 1864 Score = 27.3 bits (59), Expect = 8.9 Identities = 32/125 (25%), Positives = 47/125 (37%), Gaps = 9/125 (7%) Frame = +2 Query: 44 KQVPLNRLA-----CSLNSQLLPLEGNVRKKLCLQQQIHFARAPHGLIAKRSTRHKLRYN 208 K VPL R + SL+ + + K + Q H I R + Y+ Sbjct: 930 KNVPLTRRSWGNAQMSLDQSTVSILNKCHAKFIIASQ-------HAQIVLVPGRRFIGYS 982 Query: 209 CVKLILLRPSQLQ----DRGYTYASCSKAFQYLEHDGFWCIALRSHAPGLCIVSTSCCCF 376 L P +Q DR Y + + +Y+E D C+ H+ L +S SC Sbjct: 983 HFFCNLKHPLMVQIETADRTYFHRYQPENMEYIE-DSELCVY---HSSCLEDISHSCWDL 1038 Query: 377 FCWGP 391 FCW P Sbjct: 1039 FCWDP 1043 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,553,384 Number of Sequences: 219361 Number of extensions: 982909 Number of successful extensions: 2591 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2589 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)