Clone Name | rbastl20h01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HPS5_HUMAN (Q9UPZ3) Hermansky-Pudlak syndrome 5 protein (Alpha-i... | 30 | 3.0 | 2 | RENT1_SCHPO (Q09820) Regulator of nonsense transcripts 1 homolog... | 29 | 5.1 | 3 | BCAR3_BOVIN (Q58DL5) Breast cancer anti-estrogen resistance prot... | 28 | 6.7 |
---|
>HPS5_HUMAN (Q9UPZ3) Hermansky-Pudlak syndrome 5 protein (Alpha-integrin-binding| protein 63) (Ruby-eye protein 2 homolog) (Ru2) Length = 1129 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 288 RFDWLSVPVIL*NPPCSSSLVKG--RRPHSQLRSW 386 R DWL + V L PP +S++ RPHS L SW Sbjct: 920 RLDWLLLAVSLDAPPSTSTMDDEGYPRPHSHLLSW 954
>RENT1_SCHPO (Q09820) Regulator of nonsense transcripts 1 homolog (EC 3.6.1.-)| (ATP-dependent helicase SPAC16C9.06c) Length = 925 Score = 28.9 bits (63), Expect = 5.1 Identities = 23/79 (29%), Positives = 33/79 (41%) Frame = -2 Query: 256 CNRSFCALVAKDRTDIHISLLTNDVRLSFPLSRKTFLIFHFHRPLQHSVCIAH*TAGTTG 77 CN+ FC + K IS L +R + H H L +V + GT Sbjct: 61 CNKWFCNVRGKSGASHIISHLVR--------ARHKQVALHSHSSLSDTVLECY-NCGTRN 111 Query: 76 VGMLLFLPAELTFMFQLLC 20 V +L F+PA+ + LLC Sbjct: 112 VFLLGFIPAKAKTVVVLLC 130
>BCAR3_BOVIN (Q58DL5) Breast cancer anti-estrogen resistance protein 3| Length = 826 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -1 Query: 335 TWRVLEDDRHTQPVKPPL*CKEGTGDMQQKFLCPCCKGQDRYSYKPS 195 ++ +L+DD T+P KPP + G+ Q F+ P + S+KP+ Sbjct: 475 SYLILDDDDRTRPWKPPPAPGDTVGEDQDTFVMPLL--ETTSSFKPN 519 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,308,996 Number of Sequences: 219361 Number of extensions: 1203938 Number of successful extensions: 2809 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2808 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)