Clone Name | rbastl20g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BGL1_BACSU (P40740) Beta-glucosidase (EC 3.2.1.21) (Gentiobiase)... | 28 | 7.9 |
---|
>BGL1_BACSU (P40740) Beta-glucosidase (EC 3.2.1.21) (Gentiobiase) (Cellobiase)| (Beta-D-glucoside glucohydrolase) (Amygdalase) Length = 469 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -1 Query: 100 FVASVICHKSYPEVLSNSCLACIMGARTTYSL 5 FVAS + K+ +++ +S + C++ A TTY + Sbjct: 209 FVASALAVKAGHDIIPDSKIGCMIAATTTYPM 240 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,520,034 Number of Sequences: 219361 Number of extensions: 645801 Number of successful extensions: 1570 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1569 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)