Clone Name | rbastl20f05 |
---|---|
Clone Library Name | barley_pub |
>MSHM_SARGL (O63852) Mitochondrial MutS protein homolog| Length = 982 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 21 TIKNKYFQKEGYNIFFSSKKMT 86 +IK +YF KEGY SSKK+T Sbjct: 530 SIKAEYFNKEGYAFSISSKKLT 551
>CP4Z1_HUMAN (Q86W10) Cytochrome P450 4Z1 (EC 1.14.14.1) (CYPIVZ1)| Length = 505 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 16 KARLKTSIFKRKDTTSSFLQKR*HTAHAYPQHQQ 117 +A +KT +F DTTSS + + YP+HQQ Sbjct: 305 QAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQ 338
>CTR1_ANOGA (Q27289) Chymotrypsin-1 precursor (EC 3.4.21.1)| Length = 259 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 114 AK*SSAPYSPLHSIPGPASTTSWSLLNNSW 203 AK SAPY +PG SLLNN W Sbjct: 39 AKNGSAPYQVSLQVPGWGHNCGGSLLNNRW 68
>CTR2_ANOGA (Q17025) Chymotrypsin-2 precursor (EC 3.4.21.1)| Length = 258 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 114 AK*SSAPYSPLHSIPGPASTTSWSLLNNSW 203 AK SAPY +PG SLLNN W Sbjct: 39 AKNGSAPYQVSLQVPGWGHNCGGSLLNNRW 68
>P53_RABIT (Q95330) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 391 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 99 IPATPAK*SSAPYSPLHSIPGPASTTSWSL 188 +PA PA + AP +P + P PA TSW L Sbjct: 63 VPAAPAPEAPAPAAPALAAPAPA--TSWPL 90
>KNRL_DROME (P13054) Knirps-related protein| Length = 647 Score = 27.7 bits (60), Expect = 8.6 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +1 Query: 100 YPQHQQNNLLHLTPPYTPFQDQPRLPAG 183 + +++ ++ +TPP++P Q + R PAG Sbjct: 460 HDDEEEDLVVSMTPPHSPAQQEERTPAG 487
>FBF1_CAEEL (Q9N5M6) Fem-3 mRNA-binding factor 1| Length = 614 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 10 SPKARLKTSIFKRKDTTSSFLQKR*HTAHAYPQHQQNNLLHLTPPYTPFQD 162 SP A+ +TS++ F + Y +HQQN+++ PP TP D Sbjct: 33 SPMAQHETSMWNFNSLNPYFSMLNMNDGMNYARHQQNHIVTSRPP-TPLTD 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,356,039 Number of Sequences: 219361 Number of extensions: 597923 Number of successful extensions: 1849 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1849 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)