Clone Name | rbastl20e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | REG3B_MOUSE (P35230) Regenerating islet-derived protein 3 beta p... | 30 | 2.0 | 2 | REG3G_RAT (P42854) Regenerating islet-derived protein 3 gamma pr... | 28 | 5.9 |
---|
>REG3B_MOUSE (P35230) Regenerating islet-derived protein 3 beta precursor (Reg| III-beta) (Pancreatitis-associated protein 1) Length = 175 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 274 LLLHEGQGHRRLTDVPSLFIQC*RGAKLFFSYLVLIFR 161 +LL + QG L ++PS I C +G++ + SY +F+ Sbjct: 19 MLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQ 56
>REG3G_RAT (P42854) Regenerating islet-derived protein 3 gamma precursor (Reg| III-gamma) (Pancreatitis-associated protein 3) Length = 174 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 274 LLLHEGQGHRRLTDVPSLFIQC*RGAKLFFSYLVLIF 164 +LL + QG DVP+ I C +G++ + SY +F Sbjct: 19 MLLSQVQGEDAKEDVPTSRISCPKGSRAYGSYCYALF 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,105,464 Number of Sequences: 219361 Number of extensions: 427550 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)