Clone Name | rbastl20e01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OR3A2_PANTR (Q9TU97) Olfactory receptor 3A2 | 31 | 1.3 | 2 | BRAF_PSEAE (P21629) High-affinity branched-chain amino acid tran... | 30 | 2.9 | 3 | PLXB1_HUMAN (O43157) Plexin-B1 precursor (Semaphorin receptor SEP) | 29 | 4.9 | 4 | VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF) | 28 | 8.4 |
---|
>OR3A2_PANTR (Q9TU97) Olfactory receptor 3A2| Length = 315 Score = 31.2 bits (69), Expect = 1.3 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -3 Query: 183 ACGSLRRGSASSWQSVLTCCVSHVGVVGLMCLFFG----RYMR-GAEQS 52 A LR S W+ + C SH+ VV CLFFG YMR G+E++ Sbjct: 225 AAAVLRIRSVEGWKKAFSTCGSHLTVV---CLFFGTGIFNYMRLGSEEA 270
>BRAF_PSEAE (P21629) High-affinity branched-chain amino acid transport| ATP-binding protein braF Length = 255 Score = 30.0 bits (66), Expect = 2.9 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +3 Query: 42 RSYKTVLLRAYNDRKTNTSVRQHRHVTRNTLKRSAKTTPTLSSASHKLSYSELLYSAATV 221 R+++ V L N V QHRH+ N L KT S + Y+ + Sbjct: 84 RTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRRSEREAMEYAAHWLEEVNL 143 Query: 222 SQHRNKSAG 248 ++ N+SAG Sbjct: 144 TEFANRSAG 152
>PLXB1_HUMAN (O43157) Plexin-B1 precursor (Semaphorin receptor SEP)| Length = 2135 Score = 29.3 bits (64), Expect = 4.9 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -3 Query: 453 PGAAAPAAFSIWGPWIPSIXXXXXXXXXXXXPSEPGGRNPERLPG 319 PGA+ P+ S WGPW S EP +P+ PG Sbjct: 726 PGAS-PSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPG 769
>VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF)| Length = 2813 Score = 28.5 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 95 ISPTTPTCDTQHVKTLCQD 151 +SP T TC + HVK +CQ+ Sbjct: 305 VSPCTRTCQSLHVKEVCQE 323 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,778,396 Number of Sequences: 219361 Number of extensions: 887882 Number of successful extensions: 2531 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2530 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)