| Clone Name | rbastl20c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DEGP7_ARATH (Q8RY22) Protease Do-like 7 (EC 3.4.21.-) | 34 | 0.076 | 2 | CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7) | 32 | 0.49 | 3 | PNS1_NEUCR (Q870V7) Protein PNS1 | 28 | 4.1 | 4 | RCNA_ECOLI (P76425) Nickel/cobalt efflux system rcnA | 27 | 9.2 | 5 | RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA | 27 | 9.2 | 6 | MFD_BUCAI (P57381) Transcription-repair coupling factor (EC 3.6.... | 27 | 9.2 | 7 | RCNA_ECO57 (Q8X3U5) Nickel/cobalt efflux system rcnA | 27 | 9.2 |
|---|
>DEGP7_ARATH (Q8RY22) Protease Do-like 7 (EC 3.4.21.-)| Length = 1097 Score = 34.3 bits (77), Expect = 0.076 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 374 PTWELTFEPETDTCKRRTIKALQ 306 PTWEL F+PET +R +KALQ Sbjct: 1075 PTWELRFDPETALWRRNILKALQ 1097
>CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 401 Score = 31.6 bits (70), Expect = 0.49 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 118 QLSTGNEIPMSSIELHYILVPTLTLAHRHRQHFKVPRLSMLG 243 +L G+EI +S++E H L+P LAHR H V L G Sbjct: 106 RLEAGDEIAISALEHHANLLPWQQLAHRRNLHLVVLPLDAHG 147
>PNS1_NEUCR (Q870V7) Protein PNS1| Length = 554 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 127 WIIGLRGVSFLYLFHIFLLSCRSNKPFSDFALVSTIFPQKV 5 W G+ + F+ L +F SCRS PFS L + I KV Sbjct: 207 WSGGIVFLIFVVLQALFFWSCRSRIPFSTLMLQTAIDVSKV 247
>RCNA_ECOLI (P76425) Nickel/cobalt efflux system rcnA| Length = 274 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 307 SQPWLDLFCLVVIFSVGLL*EGQAWRGE 224 ++PWL L V+I S + WRGE Sbjct: 86 AEPWLQLISAVIIISTAFWMFWRTWRGE 113
>RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA| Length = 274 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 307 SQPWLDLFCLVVIFSVGLL*EGQAWRGE 224 ++PWL L V+I S + WRGE Sbjct: 86 AEPWLQLISAVIIISTAFWMFWRTWRGE 113
>MFD_BUCAI (P57381) Transcription-repair coupling factor (EC 3.6.1.-) (TRCF)| (ATP-dependent helicase mfd) Length = 812 Score = 27.3 bits (59), Expect = 9.2 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 11/80 (13%) Frame = +1 Query: 85 EIGTEKTHPAVQLSTGNEIPMSSIELHYILVPTLTLAHRHRQHFK---------VPRLSM 237 ++G KT A++ S + +S+ + ILVPT LA +H ++FK + LS Sbjct: 294 DVGFGKTEIAMRASF---LAVSNKKQVAILVPTTLLAQQHYKNFKIRFSNWPVNINILSR 350 Query: 238 LGLPKEGPL--KISQQGRIN 291 KE L K ++ GRIN Sbjct: 351 FQTQKEQDLIFKHTKNGRIN 370
>RCNA_ECO57 (Q8X3U5) Nickel/cobalt efflux system rcnA| Length = 283 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 307 SQPWLDLFCLVVIFSVGLL*EGQAWRGE 224 ++PWL L V+I S + WRGE Sbjct: 86 AEPWLQLISAVIIISTAFWMFWRTWRGE 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,753,390 Number of Sequences: 219361 Number of extensions: 969121 Number of successful extensions: 2146 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2145 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)