Clone Name | rbastl20b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1349_HAEIN (P45173) Protein HI1349 | 32 | 0.59 | 2 | KUP2_BIFLO (Q8G7Q3) Probable potassium transport system protein ... | 30 | 2.3 |
---|
>Y1349_HAEIN (P45173) Protein HI1349| Length = 160 Score = 32.0 bits (71), Expect = 0.59 Identities = 17/39 (43%), Positives = 28/39 (71%) Frame = +2 Query: 254 KIKQDSAPRVSDSRDCISNTIMIKITVIRQQRSILSPAN 370 +IK+D A VS++++C+S T+ T++ QQR IL+ AN Sbjct: 90 RIKEDIA--VSEAQECLSGTLQGLKTLLDQQREILAFAN 126
>KUP2_BIFLO (Q8G7Q3) Probable potassium transport system protein kup 2| Length = 736 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -1 Query: 387 LPCLPMLAGERMLRCCLMTVIFIIMVFDIQSRESETLG 274 LP L L E ++TV+ I+++F +QSR +E++G Sbjct: 120 LPPLEGLFDENPSLTLMITVVIIVILFSVQSRGTESIG 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,912,571 Number of Sequences: 219361 Number of extensions: 1046457 Number of successful extensions: 2167 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2167 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)