ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl20b01 |
|---|---|
| Clone Library Name | barley_pub |
>GRP2_NICSY (P27484) Glycine-rich protein 2| Length = 214 Score = 38.9 bits (89), Expect = 0.006 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -3 Query: 456 GANSGTAGLCYKCNQPGHFARDCQGQAATPQRQAYGNGAASG 331 G SG C+KC + GHFARDC +G G G Sbjct: 150 GGGSGGGSGCFKCGESGHFARDCSQSGGGGGGGRFGGGGGGG 191 Score = 36.6 bits (83), Expect = 0.032 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 456 GANSGTAGLCYKCNQPGHFARDC 388 G G G CYKC + GHFAR+C Sbjct: 187 GGGGGGGGGCYKCGEDGHFAREC 209
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 38.5 bits (88), Expect = 0.008 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYN 322 CY CNQPGHF RDC P++ G G SG+ N Sbjct: 232 CYNCNQPGHFKRDC----PNPRK---GKGETSGQKN 260
>GRP2B_ARATH (Q38896) Glycine-rich protein 2b (AtGRP2b)| Length = 201 Score = 36.2 bits (82), Expect = 0.042 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -3 Query: 459 AGANSGTAG--LCYKCNQPGHFARDC-QGQAATPQRQAYGNGAASGRY 325 +G G G C+KC +PGH AR+C QG Y G GRY Sbjct: 126 SGGRGGGGGDNSCFKCGEPGHMARECSQGGG------GYSGGGGGGRY 167 Score = 35.0 bits (79), Expect = 0.093 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 456 GANSGTAGL-CYKCNQPGHFARDCQGQAA 373 G G GL CY C + GHFARDC A Sbjct: 172 GGGGGGGGLSCYSCGESGHFARDCTSGGA 200
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 36.2 bits (82), Expect = 0.042 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 8/35 (22%) Frame = -3 Query: 432 LCYKCNQPGHFARDC--------QGQAATPQRQAY 352 +C+KC QPGHF++ C QG PQ+Q + Sbjct: 401 VCFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTF 435
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 36.2 bits (82), Expect = 0.042 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 8/35 (22%) Frame = -3 Query: 432 LCYKCNQPGHFARDC--------QGQAATPQRQAY 352 +C+KC QPGHF++ C QG PQ+Q + Sbjct: 401 VCFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTF 435
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 36.2 bits (82), Expect = 0.042 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 8/35 (22%) Frame = -3 Query: 432 LCYKCNQPGHFARDC--------QGQAATPQRQAY 352 +C+KC QPGHF++ C QG PQ+Q + Sbjct: 401 VCFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTF 435
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 35.8 bits (81), Expect = 0.055 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -3 Query: 429 CYKCNQPGHFARDC---QGQAATPQRQAYGNGAASGRYN 322 CYKC Q GH +RDC QG + Q G A G Y+ Sbjct: 99 CYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYS 137 Score = 34.3 bits (77), Expect = 0.16 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 459 AGANSGTAG--LCYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQSY 310 +GA G +G CYKC GH +RDC G G SG +R Y Sbjct: 130 SGAQGGYSGDRTCYKCGDAGHISRDCPN----------GQGGYSGAGDRTCY 171 Score = 32.7 bits (73), Expect = 0.46 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 459 AGANSGTAGLCYKCNQPGHFARDC 388 AG+ CYKC +PGH +R+C Sbjct: 214 AGSTGSGDRACYKCGKPGHISREC 237 Score = 32.3 bits (72), Expect = 0.61 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 456 GANSGTAGLCYKCNQPGHFARDC 388 G+ G CYKC + GH +RDC Sbjct: 246 GSRGGGDRTCYKCGEAGHISRDC 268 Score = 32.3 bits (72), Expect = 0.61 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 453 ANSGTAGL--CYKCNQPGHFARDCQGQA 376 A SG AG C++C + GH +RDC A Sbjct: 62 ARSGAAGAMTCFRCGEAGHMSRDCPNSA 89 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQSY 310 CYKC GH +RDC G G SG +R+ Y Sbjct: 170 CYKCGDAGHISRDCPN----------GQGGYSGAGDRKCY 199 Score = 30.0 bits (66), Expect = 3.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAAT 370 CYKC + GH +R+C +T Sbjct: 198 CYKCGESGHMSRECPSAGST 217
>GAG_SIVVG (P27978) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 521 Score = 34.3 bits (77), Expect = 0.16 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQ 379 C KC +PGH A+DC+GQ Sbjct: 425 CLKCGKPGHLAKDCRGQ 441
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 34.3 bits (77), Expect = 0.16 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQ 379 C KC +PGH A+DC+GQ Sbjct: 421 CLKCGKPGHLAKDCRGQ 437
>BYR3_SCHPO (P36627) Cellular nucleic acid-binding protein homolog| Length = 179 Score = 34.3 bits (77), Expect = 0.16 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 432 LCYKCNQPGHFARDC 388 LCYKCNQPGH A +C Sbjct: 158 LCYKCNQPGHIAVNC 172 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 429 CYKCNQPGHFARDCQ 385 CYKC + GH ARDC+ Sbjct: 85 CYKCGRVGHIARDCR 99 Score = 28.5 bits (62), Expect = 8.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 432 LCYKCNQPGHFARDC 388 +CY CNQ GH A +C Sbjct: 37 ICYNCNQTGHKASEC 51
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQGQAATPQRQAYGNG 343 LCY CN+PGH DC +Q Y G Sbjct: 24 LCYNCNKPGHVQTDCTMPRTVEFKQCYNCG 53 Score = 32.3 bits (72), Expect = 0.61 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -3 Query: 444 GTAGL-CYKCNQPGHFARDCQ 385 G +GL CY C Q GH +RDCQ Sbjct: 112 GISGLKCYTCGQAGHMSRDCQ 132 Score = 30.8 bits (68), Expect = 1.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 432 LCYKCNQPGHFARDC 388 LCY CN+ GH ++DC Sbjct: 136 LCYNCNETGHISKDC 150 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAA 337 CYKC P H A+DC + + Y G A Sbjct: 94 CYKCGGPNHMAKDCMKEDGISGLKCYTCGQA 124 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 441 TAGLCYKCNQPGHFARDC 388 T C+ CNQ GH +R+C Sbjct: 63 TVQRCFNCNQTGHISREC 80
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 33.5 bits (75), Expect = 0.27 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQGQAATPQRQAYGNGAASG 331 +CY C QPGH +R+C + + + G G +G Sbjct: 184 VCYNCQQPGHTSRECTEERKPREGRTGGFGGGAG 217
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 33.1 bits (74), Expect = 0.36 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQGQAATPQRQAYGNGAASG 331 +CY C QPGH +RDC + + + G +SG Sbjct: 283 VCYNCQQPGHNSRDCPEERKPREGRNGFTGGSSG 316 Score = 32.0 bits (71), Expect = 0.79 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQGQAATPQRQAYGNGAASG 331 +CY C QPGH +RDC + + + NG SG Sbjct: 397 VCYNCQQPGHNSRDCPEERKPREGR---NGFTSG 427
>GAG_BLVJ (P03344) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 32.7 bits (73), Expect = 0.46 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 435 GLCYKCNQPGHFARDCQGQAATP 367 G CY+C + GH+ARDC +A P Sbjct: 344 GPCYRCLKEGHWARDCPTKATGP 366
>GAG_RSVP (P03322) Gag polyprotein [Contains: Core protein p19; Core protein| p2A; Core protein p2B; Core protein p10; Capsid protein p27; Inner coat protein p12; Protease p15 (EC 3.4.23.-)] Length = 701 Score = 32.3 bits (72), Expect = 0.61 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 456 GANSGTAGLCYKCNQPGHFARDCQGQAATPQRQAYGN 346 G+ GLCY C PGH+ QA P+++ GN Sbjct: 500 GSGGRARGLCYTCGSPGHY------QAQCPKKRKSGN 530
>GAG_MPMV (P07567) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp24; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 656 Score = 32.3 bits (72), Expect = 0.61 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQA 376 N G C+KC + GHFA++C A Sbjct: 541 NKEKGGCCFKCGKKGHFAKNCHEHA 565
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 32.0 bits (71), Expect = 0.79 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 429 CYKCNQPGHFARDC 388 CY C +PGH ARDC Sbjct: 93 CYNCGKPGHLARDC 106 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQ 379 +S +CY+C + GH A+DC Q Sbjct: 41 SSSLPDICYRCGESGHLAKDCDLQ 64 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQA 376 CY+C + GH AR+C +A Sbjct: 153 CYRCGESGHLARECTIEA 170 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNG 343 CY C + GH A+DC+ ++ Y G Sbjct: 69 CYNCGRGGHIAKDCKEPKREREQCCYNCG 97
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.0 bits (71), Expect = 0.79 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 429 CYKCNQPGHFARDC 388 CY C +PGH ARDC Sbjct: 98 CYNCGKPGHLARDC 111 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQ 379 +S +CY+C + GH A+DC Q Sbjct: 47 SSSLPDICYRCGESGHLAKDCDLQ 70 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQA 376 CY+C + GH AR+C +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNG 343 CY C + GH A+DC+ ++ Y G Sbjct: 74 CYNCGRGGHIAKDCKEPKREREQCCYNCG 102
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.0 bits (71), Expect = 0.79 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 429 CYKCNQPGHFARDC 388 CY C +PGH ARDC Sbjct: 98 CYNCGKPGHLARDC 111 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQ 379 +S +CY+C + GH A+DC Q Sbjct: 47 SSSLPDICYRCGESGHLAKDCDLQ 70 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQA 376 CY+C + GH AR+C +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNG 343 CY C + GH A+DC+ ++ Y G Sbjct: 74 CYNCGRGGHIAKDCKEPKREREQCCYNCG 102
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.0 bits (71), Expect = 0.79 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 429 CYKCNQPGHFARDC 388 CY C +PGH ARDC Sbjct: 98 CYNCGKPGHLARDC 111 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQ 379 +S +CY+C + GH A+DC Q Sbjct: 47 SSSLPDICYRCGESGHLAKDCDLQ 70 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQA 376 CY+C + GH AR+C +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNG 343 CY C + GH A+DC+ ++ Y G Sbjct: 74 CYNCGRGGHIAKDCKEPKREREQCCYNCG 102
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 32.0 bits (71), Expect = 0.79 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 429 CYKCNQPGHFARDC 388 CY C +PGH ARDC Sbjct: 99 CYNCGKPGHLARDC 112 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQGQ 379 +S +CY+C + GH A+DC Q Sbjct: 47 SSSLPDICYRCGESGHLAKDCDLQ 70 Score = 28.9 bits (63), Expect = 6.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQA 376 CY+C + GH AR+C +A Sbjct: 159 CYRCGESGHLARECTIEA 176 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNG 343 CY C + GH A+DC+ ++ Y G Sbjct: 75 CYNCGRGGHIAKDCKEPKREREQCCYNCG 103
>GLH4_CAEEL (O76743) ATP-dependent RNA helicase glh-4 (EC 3.6.1.-) (Germline| helicase 4) Length = 1156 Score = 32.0 bits (71), Expect = 0.79 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 435 GLCYKCNQPGHFARDCQGQ 379 G C C Q GHFA+DCQ + Sbjct: 639 GPCRNCGQEGHFAKDCQNE 657
>GAG_BIV27 (P19559) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 31.6 bits (70), Expect = 1.0 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQSYVGS 301 CY C +PGH AR+C+ + YG + QS + S Sbjct: 423 CYHCGKPGHQARNCRSKNGKCSSAPYGQRSQPQNNFHQSNMSS 465
>GAG_BIV06 (P19558) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 31.6 bits (70), Expect = 1.0 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQSYVGS 301 CY C +PGH AR+C+ + YG + QS + S Sbjct: 423 CYHCGKPGHQARNCRSKNGKCSSAPYGQRSQPQNNFHQSNMSS 465
>GAG_SRV1 (P04022) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 657 Score = 31.6 bits (70), Expect = 1.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDC 388 N G C+KC + GHFA++C Sbjct: 542 NKEKGGCCFKCGRKGHFAKNC 562
>GAG_SRV2 (P51516) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 653 Score = 31.6 bits (70), Expect = 1.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 435 GLCYKCNQPGHFARDCQ 385 G C+KC + GHFA+DC+ Sbjct: 543 GGCFKCGKKGHFAKDCR 559
>ZCHC5_HUMAN (Q8N8U3) Zinc finger CCHC domain-containing protein 5| Length = 475 Score = 31.2 bits (69), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 432 LCYKCNQPGHFARDC 388 LC C PGHFARDC Sbjct: 444 LCLYCGYPGHFARDC 458
>GAG_CAEVC (P33458) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 441 Score = 31.2 bits (69), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 456 GANSGTAGLCYKCNQPGHFARDCQ 385 G +G CY C +PGH AR C+ Sbjct: 372 GKGNGQPQRCYNCGKPGHQARQCR 395
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 31.2 bits (69), Expect = 1.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 435 GLCYKCNQPGHFARDCQGQAATP 367 G CY+C + GH+ARDC + P Sbjct: 344 GPCYRCLKEGHWARDCPTKTTGP 366
>GAG_FIVSD (P19027) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 31.2 bits (69), Expect = 1.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G+ +C+ C +PGH AR C+ Sbjct: 370 SKGSGPVCFNCKKPGHLARQCR 391
>GAG_FIVPE (P16087) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 31.2 bits (69), Expect = 1.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G+ +C+ C +PGH AR C+ Sbjct: 370 SKGSGPVCFNCKKPGHLARQCR 391
>YHU9_YEAST (P32900) Hypothetical 81.8 kDa protein in IMP3-SPO12 intergenic| region Length = 734 Score = 30.8 bits (68), Expect = 1.8 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -1 Query: 455 VPTPAQLACATSVTSLGTLPETVRGRLLP-RSARLTGTALRP 333 +PTPA LA + S SL + + +LL ++ARL GTAL P Sbjct: 556 LPTPAYLAQSASSHSLTSFKRPNKQQLLQLQTARLNGTALNP 597
>MUTL_SALTY (P14161) DNA mismatch repair protein mutL| Length = 618 Score = 30.4 bits (67), Expect = 2.3 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 204 EATSKGLPVEAIAPATKTDRSKMLSGRPKYFRSYRHRTAGCTFRTQRRSRKPGAAG*QPA 383 + T LP+E IAPA + + ++ +F TA T R S GA+G Sbjct: 332 QQTETALPLEEIAPAPRHVQENRIAAGRNHFAVPAEPTAAREPATPRYS--GGASGGNGG 389 Query: 384 PDSL--WQSAQAGYTCSTGQLCRS 449 S W AQ GY G++ R+ Sbjct: 390 RQSAGGWPHAQPGYQKQQGEVYRT 413
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQ 379 C KC + GH A+DC+GQ Sbjct: 420 CLKCGKLGHLAKDCRGQ 436
>GAG_FIVWO (Q05313) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 30.4 bits (67), Expect = 2.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G +C+ C +PGH AR C+ Sbjct: 370 SKGPGPVCFNCKRPGHLARQCR 391
>GAG_VILV2 (P23425) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G CY C +PGH AR C+ Sbjct: 380 HKGVNQKCYNCGKPGHLARQCR 401
>GAG_VILV1 (P23424) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G CY C +PGH AR C+ Sbjct: 380 HKGVNQKCYNCGKPGHLARQCR 401
>GAG_VILV (P03352) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 450 NSGTAGLCYKCNQPGHFARDCQ 385 + G CY C +PGH AR C+ Sbjct: 380 HKGVNQKCYNCGKPGHLARQCR 401
>ZCH13_HUMAN (Q8WW36) Zinc finger CCHC domain-containing protein 13| Length = 166 Score = 30.0 bits (66), Expect = 3.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQGQAATPQRQAYGNG 343 +CY C + GH A+DC+ ++ Y G Sbjct: 66 ICYNCGRSGHIAKDCKDPKRERRQHCYTCG 95 Score = 28.9 bits (63), Expect = 6.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQ 379 CY C + GH ARDC Q Sbjct: 91 CYTCGRLGHLARDCDRQ 107
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 30.0 bits (66), Expect = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 429 CYKCNQPGHFARDCQ 385 C+ C +PGHF +DC+ Sbjct: 460 CFNCGKPGHFKKDCR 474
>GAG_VILVK (P35955) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.0 bits (66), Expect = 3.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 429 CYKCNQPGHFARDCQ 385 CY C +PGH AR C+ Sbjct: 387 CYNCGKPGHLARQCR 401
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 30.0 bits (66), Expect = 3.0 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 429 CYKCNQPGHFARDCQ-GQAATPQRQAYGNGAASGRYNRQSYVGSF*SISVDPIA 271 C+KC + GH A+DC+ GQA YG+ + N Y G ++ ++P A Sbjct: 413 CFKCGKIGHMAKDCKNGQA---NFLGYGHWGGAKPRNFVQYRGD--TVGLEPTA 461
>POL_COYMV (P19199) Putative polyprotein [Contains: Coat protein; Protease (EC| 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1886 Score = 29.6 bits (65), Expect = 3.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQA 355 CY C Q GH+A C+ + QR A Sbjct: 881 CYICGQEGHYANQCRNKHKDQQRVA 905
>RICI_RICCO (P02879) Ricin precursor [Contains: Ricin A chain (EC 3.2.2.22)| (rRNA N-glycosidase); Linker peptide; Ricin B chain] Length = 576 Score = 29.6 bits (65), Expect = 3.9 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -3 Query: 444 GTAGLCYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQSYVGSF*SI--SVDPIA 271 G GLC + N + DC + A Q Y +G+ + NR + + S +I +V I Sbjct: 460 GLYGLCLQANSGQVWIEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKIL 519 Query: 270 SC 265 SC Sbjct: 520 SC 521
>MURI_STRP6 (Q5XDP9) Glutamate racemase (EC 5.1.1.3)| Length = 264 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 404 TLPETVRGRLLP-RSARLTGTALRPEGTTGSPMSVASEVFR 285 TL V G +LP SA + T G G+PM+VAS+++R Sbjct: 87 TLDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYR 127
>GPTC3_MOUSE (Q8BIY1) G patch domain-containing protein 3| Length = 525 Score = 29.3 bits (64), Expect = 5.1 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 14/69 (20%) Frame = -1 Query: 440 QLACATSVTSLGTLPETVRGRLLPRSAR--------------LTGTALRPEGTTGSPMSV 303 +L T V+ LG+ P R L R A L L P G G+P+ V Sbjct: 142 RLRLPTEVSDLGSFPFKTRKELQSRRAENEAFTLADLKQLPELNPPVLMPNGNVGTPLRV 201 Query: 302 ASEVFRSTR 276 E+ RS R Sbjct: 202 FLELIRSCR 210
>GAG_OMVVS (P16900) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 446 Score = 29.3 bits (64), Expect = 5.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 429 CYKCNQPGHFARDCQ 385 CY C +PGH AR C+ Sbjct: 386 CYYCGKPGHLARQCR 400
>SFRS7_MOUSE (Q8BL97) Splicing factor, arginine/serine-rich 7| Length = 267 Score = 28.9 bits (63), Expect = 6.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQS 313 CY+C + GH+A DC + + ++ + R R S Sbjct: 135 CYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYS 173
>GAG_FIVT2 (P31821) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 449 Score = 28.9 bits (63), Expect = 6.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 432 LCYKCNQPGHFARDCQ 385 +C+ C +PGH AR C+ Sbjct: 376 VCFNCKKPGHLARQCK 391 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 429 CYKCNQPGHFARDC-QGQAATPQRQAYGNGAA 337 C C +PGH A +C QG T + G AA Sbjct: 396 CNNCGKPGHLAANCWQGGRKTSGNEKVGRAAA 427
>SFRS7_HUMAN (Q16629) Splicing factor, arginine/serine-rich 7 (Splicing factor| 9G8) Length = 238 Score = 28.9 bits (63), Expect = 6.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQAYGNGAASGRYNRQS 313 CY+C + GH+A DC + + ++ + R R S Sbjct: 106 CYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYS 144
>ZCHC2_MOUSE (Q69ZB8) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 1168 Score = 28.5 bits (62), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQ 358 CY C GH+A+DC+ + +Q Sbjct: 1123 CYNCGVSGHYAQDCKQSSMEANQQ 1146
>Y4393_STRCO (Q9K3V1) UPF0309 protein SCO4393| Length = 251 Score = 28.5 bits (62), Expect = 8.7 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +1 Query: 280 VDRNTSEATDIGLPVVPSGRSAVPVSLALRGSSLPLTVSGKVPRLVTLVAQAS 438 +D + A D + + SGR+A+PV +A+ +L L V G VT VA AS Sbjct: 104 LDSSPLRAGDALVIISLSGRNALPVEMAMHARALGLRVIG-----VTSVAYAS 151
>1B78_HUMAN (P30498) HLA class I histocompatibility antigen, B-78 alpha chain| precursor (MHC class I antigen B*78) Length = 362 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 135 RGDAIAAQLKTEPRCYWVGQNTSEATSKGLPVEAIAPATKTDRSKMLSGRPKYFRS 302 R D+ AA +TEPR W+ Q E + + T+TDR + + R Y +S Sbjct: 59 RFDSDAASPRTEPRAPWIEQEGPEYWDRN--TQIFKTNTQTDRESLRNLRGYYNQS 112
>RS2_MYCPA (Q73VQ7) 30S ribosomal protein S2| Length = 276 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 129 ITRGDAIAAQLKTEPRCYWVGQNTSEATSKGLPVEAIAPATKTDRS 266 + RGD EP W + + AT+ P EA AP TD S Sbjct: 231 VGRGDGKPEVEAAEPLAEWEQELLASATATAAPTEAGAPEPTTDPS 276
>ZCHC2_HUMAN (Q9C0B9) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 899 Score = 28.5 bits (62), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 429 CYKCNQPGHFARDCQGQAATPQRQ 358 CY C GH+A+DC+ + +Q Sbjct: 854 CYNCGVSGHYAQDCKQSSMEANQQ 877
>AIPL1_RAT (Q9JLG9) Aryl-hydrocarbon-interacting protein-like 1| Length = 328 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +3 Query: 24 T*HTLIY----KDLKVVAQGPDATTTHKHSRQICS*QLYITRGDAIAAQLKTEPR 176 T HT +Y + L+ VA+G D T+ H H+ + + Y T G +L+ EP+ Sbjct: 91 TIHTGVYPMLSRSLRQVAEGKDPTSWHVHTCGLANMFAYHTLGYEDLDELQKEPQ 145
>AIPL1_MOUSE (Q924K1) Aryl-hydrocarbon-interacting protein-like 1| Length = 328 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +3 Query: 24 T*HTLIY----KDLKVVAQGPDATTTHKHSRQICS*QLYITRGDAIAAQLKTEPR 176 T HT +Y + L+ VA+G D T+ H H+ + + Y T G +L+ EP+ Sbjct: 91 TIHTGVYPMLSRSLRQVAEGKDPTSWHVHTCGLANMFAYHTLGYEDLDELQKEPQ 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,731,936 Number of Sequences: 219361 Number of extensions: 1477200 Number of successful extensions: 4627 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 4305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4626 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
