Clone Name | rbastl20a05 |
---|---|
Clone Library Name | barley_pub |
>CRI4_MAIZE (O24585) Putative receptor protein kinase CRINKLY4 precursor (EC| 2.7.11.1) Length = 901 Score = 92.0 bits (227), Expect = 6e-19 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -1 Query: 456 KSSASEADLDGRTTTDGRNVGSSIGDGLRSLEEEIGPASPQENLYLQHNF 307 KSSASEAD+ GR TDGRNVGSSIGDGLRSLEEEI PASPQENLYLQHNF Sbjct: 852 KSSASEADIVGRRATDGRNVGSSIGDGLRSLEEEIAPASPQENLYLQHNF 901
>SYFB_BORPE (Q7VVR5) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 306 RSCAASTGSPVETPAQSLPPVTADHLL 386 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>SYFB_BORPA (Q7W7C6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 306 RSCAASTGSPVETPAQSLPPVTADHLL 386 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>SYFB_BORBR (Q7WKR4) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 306 RSCAASTGSPVETPAQSLPPVTADHLL 386 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 442 GSRPGWPNNHRWEECREQHRRWSAVTGGRDW 350 G +P+ RW+ CR H R+ A+ RDW Sbjct: 1045 GREKFYPDRPRWDRCRYYHDRY-ALYAARDW 1074
>UPPS_SULTO (Q976K2) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 262 Score = 28.9 bits (63), Expect = 6.4 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 293 RSAENMETVCRF--KFRLCDLLLWPFRREDLAI*STYWKDF*HLEAFLCRLIRS 138 + E+++ V R + R+ + LLW +L TYW DF ++ L R IRS Sbjct: 201 KELEDIDLVIRSSGEIRISNFLLWHIAYSELFFVDTYWPDFRKID--LWRAIRS 252
>RTEL1_HUMAN (Q9NZ71) Regulator of telomere elongation helicase 1 (EC 3.6.1.-)| (Helicase-like protein NHL) Length = 1400 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = -2 Query: 173 HLEAFLCRLIRSSYNCHLYL*VE----WPQLMSPVL*LADTCK 57 HL+ LCR +S +CH Y VE +L SP+L + D K Sbjct: 157 HLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVK 199
>SYL_MYCTU (P67510) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 28.5 bits (62), Expect = 8.4 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -3 Query: 364 GGRDWAGVSTGE--PVLAAQLLMKCQDQLKTWKP--SAVLSSDFVT 239 GGRDWA ++ GE V+ L+ D L W P VL+++ VT Sbjct: 211 GGRDWAKLTAGERADVIDEYRLVYRADSLVNWCPGLGTVLANEEVT 256
>SYL_MYCBO (P67511) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 28.5 bits (62), Expect = 8.4 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -3 Query: 364 GGRDWAGVSTGE--PVLAAQLLMKCQDQLKTWKP--SAVLSSDFVT 239 GGRDWA ++ GE V+ L+ D L W P VL+++ VT Sbjct: 211 GGRDWAKLTAGERADVIDEYRLVYRADSLVNWCPGLGTVLANEEVT 256
>XYNA_RUMFL (P29126) Bifunctional endo-1,4-beta-xylanase xylA precursor (EC| 3.2.1.8) Length = 954 Score = 28.5 bits (62), Expect = 8.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 430 GWPNNHRWEECREQHRRWSAVTGGRDW 350 GW NN+ W + Q+ W+ DW Sbjct: 567 GWDNNNNWNQWGGQNNDWNNQQQNNDW 593 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,479,752 Number of Sequences: 219361 Number of extensions: 1401904 Number of successful extensions: 4196 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4196 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)