Clone Name | rbastl19h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SWI10_SCHPO (Q06182) Mating-type switching protein swi10 | 28 | 7.0 | 2 | CD1B2_CAVPO (Q9QZZ1) T-cell surface glycoprotein CD1b2 precursor... | 27 | 9.2 | 3 | NRG_DROME (P20241) Neuroglian precursor | 27 | 9.2 | 4 | HN_HENDV (O89343) Hemagglutinin-neuraminidase (EC 3.2.1.18) | 27 | 9.2 |
---|
>SWI10_SCHPO (Q06182) Mating-type switching protein swi10| Length = 252 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 113 ILPSTPFIPKYKTF*RLHYILHTDVCSHILECRFTHFIPYVVYSQNSK 256 +LP +P T +++ T +CS L ++ H P +YS+ SK Sbjct: 54 LLPHVRNVPWEYTDIVPDFVMGTGICSLFLSLKYHHLHPEYIYSRISK 101
>CD1B2_CAVPO (Q9QZZ1) T-cell surface glycoprotein CD1b2 precursor (CD1-b2| antigen) Length = 332 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 259 VLYFRTEGVLWFNLACIASKLPLCIYHLLWF-KH 357 +LY+ + W LA S L + ++++LWF KH Sbjct: 292 ILYWGNSSIGWIILAVFVSCLIVLLFYVLWFYKH 325
>NRG_DROME (P20241) Neuroglian precursor| Length = 1302 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 230 YVVYSQNSKRSYISERREY 286 Y +Y + K SY+ ERREY Sbjct: 950 YKIYYEEVKESYVGERREY 968
>HN_HENDV (O89343) Hemagglutinin-neuraminidase (EC 3.2.1.18)| Length = 604 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 4/26 (15%) Frame = -2 Query: 90 IHARLSK----RLWIGVNNTSHYVIR 25 IH + SK RL +GVN+ SHY++R Sbjct: 385 IHCKYSKAENCRLSMGVNSKSHYILR 410 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,785,945 Number of Sequences: 219361 Number of extensions: 1025857 Number of successful extensions: 1985 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1985 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)