Clone Name | rbastl19h01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RS3A_ORYSA (P49397) 40S ribosomal protein S3a (CYC07 protein) | 34 | 0.19 | 2 | NAL13_HUMAN (Q86W25) NACHT-, LRR- and PYD-containing protein 13 ... | 31 | 1.6 | 3 | RS3A_HELAN (P49198) 40S ribosomal protein S3a | 30 | 2.7 | 4 | YR297_MIMIV (Q5UPY3) Hypothetical protein R297 | 28 | 7.9 |
---|
>RS3A_ORYSA (P49397) 40S ribosomal protein S3a (CYC07 protein)| Length = 261 Score = 33.9 bits (76), Expect = 0.19 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 444 EDVGVKLDRPDGDEVIPGAEEVAAAE 367 ED+G KLDRP DE + G +EVAAAE Sbjct: 237 EDIGTKLDRPAEDEAMAG-QEVAAAE 261
>NAL13_HUMAN (Q86W25) NACHT-, LRR- and PYD-containing protein 13| (Nucleotide-binding oligomerization domain protein 14) Length = 1043 Score = 30.8 bits (68), Expect = 1.6 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 2/88 (2%) Frame = +3 Query: 93 LEITTNNTVEHKVHANIKHIWQE*TKYLVSTHNLHPESNTNKTR*LNA--G*ECRQKYSR 266 LEI + + ++HA W LV+ NLH +N ++ G K R Sbjct: 700 LEILETSKFDSRMHA-----WNSICSTLVTNENLHELDLSNSKLHASSVKGLCLALKNPR 754 Query: 267 NQPSKLTTKFTTPRWHIYHLLDKKQQNS 350 + KLT K TP W + L+ Q NS Sbjct: 755 CKVQKLTCKSVTPEWVLQDLIIALQGNS 782
>RS3A_HELAN (P49198) 40S ribosomal protein S3a| Length = 259 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -3 Query: 444 EDVGVKLDRPDGDEVIPGAEEVAAA 370 EDVGVKLDRP +E P A EV A Sbjct: 236 EDVGVKLDRP-AEEAAPEATEVIGA 259
>YR297_MIMIV (Q5UPY3) Hypothetical protein R297| Length = 168 Score = 28.5 bits (62), Expect = 7.9 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +3 Query: 252 QKYSRNQPSKLTTKFTTPRWHIYHLLDKKQQNSDFY 359 ++Y+ NQP++L T+ P ++ + + + N +FY Sbjct: 80 KQYNYNQPNRLQTRSVRPNYYSGYRYNNRTGNQEFY 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,996,781 Number of Sequences: 219361 Number of extensions: 1105305 Number of successful extensions: 2342 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2342 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)