| Clone Name | rbastl19g08 |
|---|---|
| Clone Library Name | barley_pub |
>TAT_HV1JR (P20879) TAT protein (Transactivating regulatory protein)| Length = 101 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 107 CTMCAVA*LCLECLRCFTVDHLSLFYG 27 CT C CL C CFT L + YG Sbjct: 22 CTNCYCKKCCLHCQVCFTTKGLGISYG 48
>USH2A_HUMAN (O75445) Usherin precursor (Usher syndrome type-2A protein) (Usher| syndrome type IIa protein) Length = 5202 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -3 Query: 162 CCQNSVLAMS---CNAVNRQALYYVCCGMIMSGML 67 CC+ ++ S CN V L YVC I +GM+ Sbjct: 3358 CCETELIPKSQKCCNGVGYNPLKYVCSDKISTGMM 3392
>VCAP_EHV1V (Q6S6S9) Major capsid protein (MCP) (Capsid protein VP5)| Length = 1376 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 258 CEIKSLIVKTIQSY*---HEHRLIYHVYLVMMASLCCQNSVLAMSCNAVNRQALYYV 97 C + LI++ I SY H+ + + Y++M + N L C A+ R L +V Sbjct: 641 CALARLIIQCIVSYWRNTHQVAFVNNFYMIMYINAYLGNGELPEECTAIYRDLLEHV 697
>VCAP_EHV1B (P28920) Major capsid protein (MCP) (Capsid protein VP5)| Length = 1376 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 258 CEIKSLIVKTIQSY*---HEHRLIYHVYLVMMASLCCQNSVLAMSCNAVNRQALYYV 97 C + LI++ I SY H+ + + Y++M + N L C A+ R L +V Sbjct: 641 CALARLIIQCIVSYWRNTHQVAFVNNFYMIMYINAYLGNGELPEECTAIYRDLLEHV 697
>TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein)| Length = 101 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 107 CTMCAVA*LCLECLRCFTVDHLSLFYG 27 CT C C C CFT L + YG Sbjct: 22 CTSCYCKKCCFHCQVCFTTKGLGISYG 48
>TAT_HV1BR (P04610) TAT protein (Transactivating regulatory protein)| Length = 86 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 107 CTMCAVA*LCLECLRCFTVDHLSLFYG 27 CT C C C CFT L + YG Sbjct: 22 CTTCYCKKCCFHCQVCFTTKALGISYG 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,393,796 Number of Sequences: 219361 Number of extensions: 578310 Number of successful extensions: 1035 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)