Clone Name | rbastl19g03 |
---|---|
Clone Library Name | barley_pub |
>SO4A1_HUMAN (Q96BD0) Solute carrier organic anion transporter family member 4A1| (Solute carrier family 21 member 12) (Sodium-independent organic anion transporter E) (Organic anion-transporting polypeptide E) (OATP-E) (Colon organic anion transporter) (O Length = 722 Score = 32.0 bits (71), Expect = 0.88 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 333 LCHKGCPIMQQARTHRENVHRRCSC 259 LCH GCP + + V+R CSC Sbjct: 529 LCHAGCPAATETNVDGQKVYRDCSC 553
>LPAT2_BRAOL (Q6IWY1) 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (EC| 2.3.1.51) (Lysophosphatidyl acyltransferase 2) Length = 391 Score = 29.3 bits (64), Expect = 5.7 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -2 Query: 479 LQKH-AKNAFPGMLMQIVD-PVLLLSIEEASAGCLLDGSNNTMEHTSNAISSVTKVALS 309 L KH A + FPG Q +D P+ L++ S CLL H SN SS+ +ALS Sbjct: 282 LDKHIAADTFPGQKEQNIDRPIKSLAV-VVSWACLLTLGAMKFLHWSNLFSSLKGIALS 339
>UTER_HUMAN (P11684) Uteroglobin precursor (Secretoglobin family 1A member 1)| (Clara cell phospholipid-binding protein) (CCPBP) (Clara cells 10 kDa secretory protein) (CC10) (Urinary protein 1) (Urine protein 1) (UP1) Length = 91 Score = 28.9 bits (63), Expect = 7.5 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 151 MVVMFGVPSLVLVCSFLACHVCPAYRSVLSTLCVKFP 41 + V + +L L CS + +CP+++ V+ TL + P Sbjct: 3 LAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTP 39
>TRUA_XANCP (Q8P7R5) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 257 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 389 GCLLDGSNNTMEHTSNAISSVTKVALSCSKHAPTERMCIGDAAAAIHG 246 G G EH ++ + + ALS AP + +C G A +HG Sbjct: 11 GSEFQGWQQLGEHGGPSVQATLQAALSSVADAPIQVVCAGRTDAGVHG 58
>GON4L_MOUSE (Q9DB00) GON-4-like protein (GON-4 homolog)| Length = 2260 Score = 28.9 bits (63), Expect = 7.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 348 QQCHILCHKGCPIMQQARTHRENVHRRCSCCDSR 247 + C CH+G P + ++ R N H CDS+ Sbjct: 1872 KDCSCSCHEGGPESKLKKSKRRNCHCSSKVCDSK 1905
>RAFR_ECOLI (P21867) HTH-type transcriptional regulator rafR (Raffinose operon| repressor) Length = 335 Score = 28.9 bits (63), Expect = 7.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 357 HCVVASIQQTTRASFFNGQQQDWIDYLHQHPWK 455 H +A + + T S+ ++Q W+D LH+H K Sbjct: 177 HKSIALLSENTSHSYVIARRQGWLDALHEHGLK 209
>RHBD4_HUMAN (P58872) Rhomboid-related protein 4 (EC 3.4.21.105) (Ventrhoid| transmembrane protein) Length = 404 Score = 28.9 bits (63), Expect = 7.5 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 153 IWWLCLAFQAWF-WFVRFWLVMFVQLIDLSFPP 58 +WW+ +A F F FW + L+DL PP Sbjct: 370 LWWIFVAMYTVFVLFAVFWNIFAYTLLDLKLPP 402
>TRUA_XANOR (Q5GXR2) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 257 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 389 GCLLDGSNNTMEHTSNAISSVTKVALSCSKHAPTERMCIGDAAAAIHG 246 G G EH ++ + + ALS AP + +C G A +HG Sbjct: 11 GSEFQGWQQLGEHGGPSVQASLQAALSSVADAPVQVVCAGRTDAGVHG 58
>TRUA_XANAC (Q8PJ25) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 257 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 389 GCLLDGSNNTMEHTSNAISSVTKVALSCSKHAPTERMCIGDAAAAIHG 246 G G EH ++ + + ALS AP + +C G A +HG Sbjct: 11 GSEFQGWQQLGEHGGPSVQASLQAALSSVADAPVQVVCAGRTDAGVHG 58
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +2 Query: 233 SYPLCRESQQLHLLCTFSRWVRACCMIGQPL*QRIWHCWYVPLCC 367 S P C++S CTFS +ACC VP+CC Sbjct: 142 SSPCCQQSSCQSACCTFSPCQQACC---------------VPICC 171
>LASS3_HUMAN (Q8IU89) LAG1 longevity assurance homolog 3| Length = 383 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 132 FQAWFWFVRFWLVMFVQLIDL 70 F+ WFW RFWL ++ DL Sbjct: 5 FKEWFWLERFWLPPTIKWSDL 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,369,515 Number of Sequences: 219361 Number of extensions: 1472272 Number of successful extensions: 4509 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 4251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4507 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)