ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl19f12 |
|---|---|
| Clone Library Name | barley_pub |
>YE1A_CAEEL (Q5FC62) Hypothetical protein C35A5.10| Length = 286 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 18/70 (25%) Frame = -2 Query: 289 GE*VALDSSMYTPCLPCRFHCH------------------LSIRTMTHL*CSSSCCKESN 164 G V L SS Y P + C +C+ ++ + + C+SSCC +N Sbjct: 62 GNQVILPSSFYNPNMNCNSNCNNLNCNQYSGSWLNGQYVAYNMGSNAYSPCASSCCSNNN 121 Query: 163 PTSNSYMSTS 134 N Y++ + Sbjct: 122 NNYNPYINNN 131
>ENV_CAEVG (P31627) Env polyprotein precursor (Coat polyprotein) [Contains:| Leader peptide; Surface protein; Transmembrane protein] Length = 942 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 76 KSEIRIGTTETIVQICNSHHWYSCNCCW*GWTLYNKRT 189 + I + +TI C+ +W CNC G LYN T Sbjct: 433 RHNITVDRNQTITGNCSVTNWDGCNCSRSGNYLYNSTT 470
>SAHH_BORPE (Q7VUL8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 226 DNGIDKANRE-CTWRNLTPLIHHSIYP 303 DN ID A E C W + P + H I+P Sbjct: 344 DNEIDVAGLENCQWEEIKPQVDHVIFP 370
>SAHH_BORPA (Q7W1Z7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 226 DNGIDKANRE-CTWRNLTPLIHHSIYP 303 DN ID A E C W + P + H I+P Sbjct: 344 DNEIDVAGLENCQWEEIKPQVDHVIFP 370
>SAHH_BORBR (Q7WQX5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 226 DNGIDKANRE-CTWRNLTPLIHHSIYP 303 DN ID A E C W + P + H I+P Sbjct: 344 DNEIDVAGLENCQWEEIKPQVDHVIFP 370
>COX2_PERFA (Q37595) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 226 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_TARBA (P98043) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_SCICA (P50691) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_RABIT (P98049) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_MOUSE (P00405) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_MICPE (P24988) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_CRACA (P50662) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LPV +++S D+L +AVP Sbjct: 136 LEVDNRVVLPMELPVRMLVSSEDVLHSWAVP 166
>COX2_APOSY (P50673) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166
>COX2_ACOWI (P50672) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 261 MEESNATYSPFYLPVTVMISLTDLLQRFAVP 353 +E N P LP+ ++IS D+L +AVP Sbjct: 136 LEVDNRVVLPMELPIRMLISSEDVLHSWAVP 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,974,845 Number of Sequences: 219361 Number of extensions: 826083 Number of successful extensions: 1864 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1864 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
