Clone Name | rbastl19f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 29 | 3.7 | 2 | R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 29 | 3.7 | 3 | VGLL4_MOUSE (Q80V24) Transcription cofactor vestigial-like prote... | 28 | 8.3 |
---|
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 29.3 bits (64), Expect = 3.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 119 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGV 6 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3737 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3773
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 29.3 bits (64), Expect = 3.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 119 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGV 6 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3735 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3771
>VGLL4_MOUSE (Q80V24) Transcription cofactor vestigial-like protein 4 (Vgl-4)| Length = 287 Score = 28.1 bits (61), Expect = 8.3 Identities = 21/65 (32%), Positives = 27/65 (41%) Frame = +3 Query: 3 SNAPITGAANKAISLSYNHVYMPLPKYFSYVPALLYTNKATSILVGSITLRTMKSACLLR 182 S +PI AA A+SL H+Y LP AL K +S S R ++ Sbjct: 107 SRSPIERAAAPAVSLHGGHLYASLPSLMEQPLAL---TKNSSDTGRSAVERQQNRPSVIT 163 Query: 183 CQGAG 197 C AG Sbjct: 164 CASAG 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,436,778 Number of Sequences: 219361 Number of extensions: 1158234 Number of successful extensions: 2638 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2638 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)