| Clone Name | rbastl19f09 |
|---|---|
| Clone Library Name | barley_pub |
>CRI4_MAIZE (O24585) Putative receptor protein kinase CRINKLY4 precursor (EC| 2.7.11.1) Length = 901 Score = 68.2 bits (165), Expect = 8e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 418 RNVGSSIGDGLRSLEEEIGPASPQENLYLQHNF 320 RNVGSSIGDGLRSLEEEI PASPQENLYLQHNF Sbjct: 869 RNVGSSIGDGLRSLEEEIAPASPQENLYLQHNF 901
>SYFB_BORPE (Q7VVR5) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 319 RSCAASTGSPVETPAQSLPPVTADHLL 399 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>SYFB_BORPA (Q7W7C6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 319 RSCAASTGSPVETPAQSLPPVTADHLL 399 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>SYFB_BORBR (Q7WKR4) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 319 RSCAASTGSPVETPAQSLPPVTADHLL 399 R AA TG+P+ PA PVT DH L Sbjct: 177 REVAALTGTPLTAPAAEPVPVTIDHRL 203
>UPPS_SULTO (Q976K2) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 262 Score = 28.9 bits (63), Expect = 5.2 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -3 Query: 306 RSAENMETVCRF--KFRLCDLLLWPFRREDLAI*STYWKDF*HLEAFLCRLIRS 151 + E+++ V R + R+ + LLW +L TYW DF ++ L R IRS Sbjct: 201 KELEDIDLVIRSSGEIRISNFLLWHIAYSELFFVDTYWPDFRKID--LWRAIRS 252
>SYI_HAEDU (Q7VP34) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 935 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 5 NTVDENIMLICRETNNRKTTTHLHVSASYRTGLINCGHSTYK 130 N D+N+ R+T+ K T LH Y G ++ GH+ K Sbjct: 31 NWYDKNLYQQIRQTSKGKKTFILHDGPPYANGNLHLGHAVNK 72
>SYL_MYCTU (P67510) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -1 Query: 377 GGRDWAGVSTGE--PVLAAQLLMKCQDQLKTWKP--SAVLSSDFVT 252 GGRDWA ++ GE V+ L+ D L W P VL+++ VT Sbjct: 211 GGRDWAKLTAGERADVIDEYRLVYRADSLVNWCPGLGTVLANEEVT 256
>SYL_MYCBO (P67511) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -1 Query: 377 GGRDWAGVSTGE--PVLAAQLLMKCQDQLKTWKP--SAVLSSDFVT 252 GGRDWA ++ GE V+ L+ D L W P VL+++ VT Sbjct: 211 GGRDWAKLTAGERADVIDEYRLVYRADSLVNWCPGLGTVLANEEVT 256
>RTEL1_HUMAN (Q9NZ71) Regulator of telomere elongation helicase 1 (EC 3.6.1.-)| (Helicase-like protein NHL) Length = 1400 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = -3 Query: 186 HLEAFLCRLIRSSYNCHLYL*VE----WPQLMSPVL*LADTCK 70 HL+ LCR +S +CH Y VE +L SP+L + D K Sbjct: 157 HLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVK 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,045,328 Number of Sequences: 219361 Number of extensions: 1235072 Number of successful extensions: 3413 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3413 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)