Clone Name | rbastl19f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CDK7_MOUSE (Q03147) Cell division protein kinase 7 (EC 2.7.11.22... | 29 | 3.7 | 2 | HUWE1_HUMAN (Q7Z6Z7) HECT, UBA and WWE domain-containing protein... | 28 | 6.4 | 3 | INX10_CAEEL (Q22549) Innexin-10 | 28 | 8.3 |
---|
>CDK7_MOUSE (Q03147) Cell division protein kinase 7 (EC 2.7.11.22) (EC| 2.7.11.23) (CDK-activating kinase) (CAK) (TFIIH basal transcription factor complex kinase subunit) (39 kDa protein kinase) (P39 Mo15) (Protein-tyrosine kinase MPK-7) (CR4 protein kinas Length = 346 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 6/36 (16%) Frame = +3 Query: 108 EDLFKMNTCFITT------TKLPPSRPAPTPGMEMP 197 + LF N C TT TK +RP PTPG ++P Sbjct: 273 QGLFLFNPCTRTTASQALKTKYFSNRPGPTPGCQLP 308
>HUWE1_HUMAN (Q7Z6Z7) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (Mcl-1 ubiquitin ligase E3) (Mule) (ARF-binding protein 1) (ARF-BP1) Length = 4374 Score = 28.1 bits (61), Expect = 6.4 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +3 Query: 12 RLKKILEIATSSNMFL-AQSNVHQALPI*STTTEDLFKMNTCFITTTKLPPSRPAPTPGM 188 RL ++ IA N AQ+N +T T T +TT PP+ APTP Sbjct: 3455 RLLSLISIALPENKVSEAQANSGSGASSTTTATSTTSTTTTTAASTTPTPPT--APTPVT 3512 Query: 189 EMPAL 203 PAL Sbjct: 3513 SAPAL 3517
>INX10_CAEEL (Q22549) Innexin-10| Length = 559 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 17 KKNTRNCYQFKYVFSTKQCTPGSTNLIHHN*RFVQNEHMFHNHNQTPPKSTCAHAR 184 K+N +N Q Y ++ + TP + N +QN++ + N+ +TP S +R Sbjct: 490 KQNQQNATQPPYCYTNQNPTP------YQNQNQIQNQNQYSNYYRTPSLSRGTDSR 539 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,241,107 Number of Sequences: 219361 Number of extensions: 749632 Number of successful extensions: 2272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2269 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)