Clone Name | rbastl19e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-) | 33 | 0.14 |
---|
>XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-)| Length = 915 Score = 33.5 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 281 EGEKRGVTMEVGGLELPLGKSFPMTWNMHI 192 E E + V +EV GLE+ +GK F M+W M I Sbjct: 885 EEENKSVMVEVRGLEMLVGKDFNMSWKMGI 914 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,086,760 Number of Sequences: 219361 Number of extensions: 577399 Number of successful extensions: 1830 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1830 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)