Clone Name | rbastl19e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU2M_NEUCR (Q35140) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 30 | 2.9 | 2 | FCPE_MACPY (Q40301) Fucoxanthin-chlorophyll a-c binding protein ... | 30 | 2.9 | 3 | IMMA_CITFR (P05701) Colicin-A immunity protein (Microcin-A immun... | 30 | 3.8 | 4 | AMSL_ERWAM (Q46639) Amylovoran biosynthesis protein amsL | 27 | 5.1 |
---|
>NU2M_NEUCR (Q35140) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 583 Score = 30.0 bits (66), Expect = 2.9 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 329 TAMFLLFC-LFTAIILYITPFQVIALCLGFFWMRHPRFRHKVPAA 198 T +F +F L + +IL +T F I F+ MRHPRF +K P A Sbjct: 64 TQVFQIFIFLISILILQLTSFDPIKK---FYIMRHPRFINKWPRA 105
>FCPE_MACPY (Q40301) Fucoxanthin-chlorophyll a-c binding protein E, chloroplast| precursor Length = 212 Score = 30.0 bits (66), Expect = 2.9 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = -3 Query: 455 DLIRMRYDRLRHVA---GRIQ--TVVGDIATQGERLQSLLSWRDPRATA 324 D + R+DRLR+V GRI VVG I Q RL +LS+++ A A Sbjct: 57 DADQERFDRLRYVEIKHGRIAMLAVVGHITQQNTRLPGMLSFKENLAFA 105
>IMMA_CITFR (P05701) Colicin-A immunity protein (Microcin-A immunity protein)| Length = 178 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = -3 Query: 386 IATQGERLQSLLSWRDPRATAMFLLFCL---FTAIILYITPFQV 264 IAT E L S+ S +P T + ++C F A+ILYI F++ Sbjct: 48 IATSTENLPSITSSYNPLMTKVMDIYCKTAPFLALILYILTFKI 91
>AMSL_ERWAM (Q46639) Amylovoran biosynthesis protein amsL| Length = 388 Score = 26.9 bits (58), Expect(2) = 5.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 320 FLLFCLFTAIILYITPFQVIALCLGFF 240 FL F FT I+LY +P V A+ LG F Sbjct: 92 FLAFA-FTVILLYYSPLGVSAVILGLF 117 Score = 20.8 bits (42), Expect(2) = 5.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -2 Query: 210 GARSASKLLQEATCKDGLIVVKVLGHEL 127 G+++ ++L +A D LIV KV+G EL Sbjct: 158 GSQTINQLRTQA---DSLIVGKVMGAEL 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,144,049 Number of Sequences: 219361 Number of extensions: 1228099 Number of successful extensions: 3426 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3426 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)