Clone Name | rbastl19e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KITH_MYCMS (Q8VVL0) Thymidine kinase (EC 2.7.1.21) | 29 | 6.4 | 2 | AGLU_MUCJA (Q92442) Alpha-glucosidase precursor (EC 3.2.1.20) (M... | 28 | 8.4 |
---|
>KITH_MYCMS (Q8VVL0) Thymidine kinase (EC 2.7.1.21)| Length = 209 Score = 28.9 bits (63), Expect = 6.4 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 246 SYASRRVLVYTFAHFNPYVVHIEISITSIIRNGGSK*NAWTGHSSGE 386 SYA +RVL + + N Y S+ +II + GSK +++ HSS E Sbjct: 43 SYAKKRVLAFKPSIDNRY------SVENIISHSGSKLDSYLVHSSDE 83
>AGLU_MUCJA (Q92442) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 864 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/70 (24%), Positives = 31/70 (44%) Frame = +3 Query: 198 SVPKYKMFQLFSIFSDSYASRRVLVYTFAHFNPYVVHIEISITSIIRNGGSK*NAWTGHS 377 ++P Y + L+ ++S+ +R+ L+ P+V+ S G WTG + Sbjct: 515 NIPHYDIHNLYG-HAESHITRQALIKHKNKIRPFVL-----TRSSFPGSGKSVGHWTGDN 568 Query: 378 SGEWPCLQTS 407 WP L+ S Sbjct: 569 HSFWPYLKNS 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,110,672 Number of Sequences: 219361 Number of extensions: 1017888 Number of successful extensions: 2156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2156 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)