Clone Name | rbastl19e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 i... | 30 | 1.4 | 2 | ISP4_SCHPO (P40900) Sexual differentiation process protein isp4 | 28 | 4.2 | 3 | RT10_DEBHA (Q6BMB3) 30S ribosomal protein S10, mitochondrial pre... | 28 | 5.5 |
---|
>YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 intergenic| region Length = 516 Score = 30.0 bits (66), Expect = 1.4 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 2/86 (2%) Frame = +2 Query: 113 TSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGV--DVITSMQKALNGVFWYIY 286 T+K +D G +Y ++ +I N + S GV DV + + + IY Sbjct: 92 TAKTTTYDYGIAYFKQNSFDIIENDNRIDRSKVQMFSLGVIIDVQNASSDSKKHFYKEIY 151 Query: 287 YSTVHNRITGYLSGSK*SWRNETPLD 364 ++ NR + YL W + LD Sbjct: 152 HAYAANRYSSYLESLLGQWIRQRDLD 177
>ISP4_SCHPO (P40900) Sexual differentiation process protein isp4| Length = 785 Score = 28.5 bits (62), Expect = 4.2 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +2 Query: 83 YKS*RILTISTSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGVDVITSMQKAL 262 Y++ + +ST+ A F L ++ I S + +I+ ++ ++ D+ + KA Sbjct: 400 YQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEI-YDRLRDPPAPDIHEKLMKAY 458 Query: 263 NGVFWYIYYSTVHNRITGYLSGSK*SWRNETP 358 + V +Y +Y +V G + G+ W+ ETP Sbjct: 459 DEVPFY-WYLSVFLAFFGMMMGTIYGWKTETP 489
>RT10_DEBHA (Q6BMB3) 30S ribosomal protein S10, mitochondrial precursor| (Mitochondrial ribosomal small subunit protein 10) Length = 267 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 3 TTSVIRCSLKFIGKHILEGPKYPEFLH 83 T V+ L FI KH +EG KY +H Sbjct: 179 TPEVVDLWLSFINKHAIEGVKYNALIH 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,059,209 Number of Sequences: 219361 Number of extensions: 932621 Number of successful extensions: 1854 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1854 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)