ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl19c06 |
|---|---|
| Clone Library Name | barley_pub |
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 39.3 bits (90), Expect = 0.002 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 367 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 281 C DPP ++P + C+WC WC+ C S Sbjct: 1029 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1057
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 39.3 bits (90), Expect = 0.002 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 367 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 281 C DPP ++P + C+WC WC+ C S Sbjct: 1036 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1064
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 31.2 bits (69), Expect = 0.62 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 367 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 281 C DPP ++P + C+WC C C S Sbjct: 1181 CLDPPLLTVPKGGWKCKWCVSCMQCGAAS 1209
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 30.8 bits (68), Expect = 0.81 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -1 Query: 333 ELTAAVGALGAKCAVKTPNREFVPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLF 157 E AA LG TP VP A+ SL + V+ +R +P+ LF+Y HT L+ Sbjct: 173 EPAAAERVLGDVPGACTP---VVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALY 229 Query: 156 HG 151 HG Sbjct: 230 HG 231
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 2.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 213 LRMDIPSKLFSYEHTAVLFHG 151 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>PXDC2_XENLA (Q6DE92) Plexin domain-containing protein 2 precursor| Length = 513 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 19/51 (37%) Frame = -3 Query: 313 CSWCKV-------------------CSEDSKQGVCASIL*SYGVSYQVSDG 218 CSWC + C+E+SK VC +L + G+S+ + G Sbjct: 331 CSWCNIPQRCSSGFDRHRQDWVENGCTEESKDTVCDDLLQTTGISHHTTTG 381
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/43 (27%), Positives = 16/43 (37%) Frame = -3 Query: 394 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDSKQGVC 266 C GC S C+ ++ CC+ CS C Q C Sbjct: 96 CSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSC 138
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +3 Query: 207 SLSYPSLT**ETP*LQRIEAQTPCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 377 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>TRGS_TACTR (P81281) 8.6 kDa transglutaminase substrate| Length = 81 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -3 Query: 394 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCS 290 C GC S C D + A C+ C +C C+ Sbjct: 6 CSVGCDTSYCPDTSSCNCGTFADYCKCCQYCNACA 40
>POU1_BRARE (P31366) POU domain protein 1 (ZFPOU1)| Length = 425 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +3 Query: 207 SLSYPSLT**ETP*LQRIEAQTPCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 377 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 5.2 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -2 Query: 170 QLCCFMEVSVNCIVLVLCYFYFTVFKLLVSWFQNFLGILILDIL 39 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169
>MPAA5_AMBEL (P02878) Pollen allergen Amb a 5 (Amb a V) (Allergen Ra5)| Length = 45 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 334 RAYCC----RWCSWCKVCSEDSK 278 RAYCC R+C W VC E S+ Sbjct: 15 RAYCCSDPGRYCPWQVVCYESSE 37
>MPA5A_AMBPS (P43174) Pollen allergen Amb p 5a precursor (Amb p Va)| Length = 77 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 334 RAYCC----RWCSWCKVCSEDSK 278 RAYCC R+C W VC E S+ Sbjct: 37 RAYCCSDPGRYCPWQVVCYESSE 59
>MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structural maintenance| of chromosome-related protein) Length = 1499 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +3 Query: 252 QRIEAQ-TPCLESSLHTLHQEHQRQQ*AL 335 Q+++AQ TP L + LH L Q +Q+QQ A+ Sbjct: 537 QKLQAQQTPQLRAKLHELEQRYQQQQSAV 565
>MT2_CALSI (P55950) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| [Contains: Metallothionein-2A (MT-2A) (Metallothionein-IIA) (MT-IIA)] Length = 58 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -3 Query: 397 KCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 287 +CK GC C PP D C K CS+ Sbjct: 16 ECKTGCKCKSCRCPPCDKCSSECKCTSKEECSKTCSK 52
>UHMK1_RAT (Q63285) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) (PAM COOH-terminal interactor protein 2) (P-CIP2) Length = 419 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 257 NRGTNSLFGVFTAHFAPRAPT 319 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_MOUSE (P97343) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 257 NRGTNSLFGVFTAHFAPRAPT 319 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_HUMAN (Q8TAS1) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 257 NRGTNSLFGVFTAHFAPRAPT 319 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>CCL3_RAT (P50229) Small inducible cytokine A3 precursor (CCL3) (Macrophage| inflammatory protein 1-alpha) (MIP-1-alpha) Length = 92 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 284 VFTAHFAPRAPTAAVSSIRNGIPRGIFADRYSTS 385 VF+A + PTA S IPR AD + TS Sbjct: 21 VFSAPYGADTPTACCFSYGRQIPRKFIADYFETS 54
>ATP6_AEDAL (Q5JCK5) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -2 Query: 104 TVFKLLVSWFQNFLGILIL 48 T+F + ++WF F+G+LI+ Sbjct: 14 TIFNMSLNWFSTFIGLLII 32
>PROC_MYCTU (Q11141) Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C| reductase) Length = 295 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = -1 Query: 393 ANMDVLYLSAKIPRGIPFLIELTAAVGALGAKCAVKTPNREFVPLFFEAMESLIK*VTGN 214 A + + Y +K+P G P + + A +GA R P E + +L V G Sbjct: 105 AGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGV 164 Query: 213 L 211 L Sbjct: 165 L 165
>DNAK_TREDE (Q73Q16) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 646 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +3 Query: 258 IEAQTPCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQ 368 I+A+T L+ + + + +E +QQ A +G + + GSSQ Sbjct: 578 IKAKTENLQQAAYKIAEEMYKQQGAQAGADPNAGSSQ 614
>VE5_RHPV1 (P24834) Probable protein E5| Length = 157 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -3 Query: 394 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWC 302 CK C C+ PP +CC W +C Sbjct: 25 CKANCCCYACKPPP--------FCCFWLCFC 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,561,780 Number of Sequences: 219361 Number of extensions: 1106303 Number of successful extensions: 3307 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3301 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
