Clone Name | rbastl19b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BNC1_MOUSE (O35914) Zinc finger protein basonuclin-1 | 30 | 1.9 | 2 | DDX21_MOUSE (Q9JIK5) Nucleolar RNA helicase 2 (EC 3.6.1.-) (Nucl... | 29 | 5.4 | 3 | OXAA_RHILO (Q98D88) Inner membrane protein oxaA | 28 | 9.2 |
---|
>BNC1_MOUSE (O35914) Zinc finger protein basonuclin-1| Length = 961 Score = 30.4 bits (67), Expect = 1.9 Identities = 23/77 (29%), Positives = 35/77 (45%) Frame = +1 Query: 73 RQKER*RVQV*LSRKISTNKTK*KLHEMAS*QRGHDSCTRRFLPLFFTSGIKRNGSKHPS 252 RQKE R Q + +K N K HE + R +CT F S +R+ +H S Sbjct: 680 RQKEEARFQCDICKKTFKNACSMKTHEKNTHARETHACTVEGCGAAFPS--RRSRDRHSS 737 Query: 253 HVSSGSYVFDKNQAQTS 303 ++S V ++ +TS Sbjct: 738 NLSLHQKVLNEEALETS 754
>DDX21_MOUSE (Q9JIK5) Nucleolar RNA helicase 2 (EC 3.6.1.-) (Nucleolar RNA| helicase II) (Nucleolar RNA helicase Gu) (RH II/Gu) (Gu-alpha) (DEAD box protein 21) Length = 851 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 29 MGTPLRNFLEIPHNTGKKKGKEYKYNSAEKSPQIKPSKS 145 + P ++IP KKGKE ++ EKSP++K S Sbjct: 188 LSQPSEEEVDIPKPKKMKKGKEASGDAGEKSPRLKDGLS 226
>OXAA_RHILO (Q98D88) Inner membrane protein oxaA| Length = 603 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 71 TGKKKGKEYKYNSAEKSPQIKPSKSFMRWL 160 TG + +E+KY S EK Q +P K+ WL Sbjct: 245 TGTEGLQEHKYASIEKDKQYQPGKATDGWL 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,970,900 Number of Sequences: 219361 Number of extensions: 1144969 Number of successful extensions: 3272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3272 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)