Clone Name | rbastl19a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DP2L_ARCFU (O28552) DNA polymerase II large subunit (EC 2.7.7.7)... | 27 | 9.6 | 2 | Y013_RICCN (Q92JQ4) Hypothetical UPF0079 protein RC0013 | 27 | 9.6 |
---|
>DP2L_ARCFU (O28552) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1143 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 277 CDLAGSTTHQGFYCPSGR 330 CD+ G T Q +YCPS R Sbjct: 663 CDVCGELTEQLYYCPSCR 680
>Y013_RICCN (Q92JQ4) Hypothetical UPF0079 protein RC0013| Length = 175 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 292 ILPNHKDLPTNSSTITKVHDEPFFSTSLYIK 200 I+ NHK+ SS I + D P F T L I+ Sbjct: 134 IITNHKENSQESSLIDFLQDSPLFDTKLDIQ 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,283,405 Number of Sequences: 219361 Number of extensions: 1080176 Number of successful extensions: 1897 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1897 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)