Clone Name | rbastl19a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL697_MIMIV (Q5UNV8) Hypothetical protein L697 | 28 | 6.0 | 2 | NU4M_ASTPE (P11992) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 28 | 7.8 |
---|
>YL697_MIMIV (Q5UNV8) Hypothetical protein L697| Length = 375 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 27 KIWIKENVEDNCVYAEFKNLASRYVVVV*FNCFYQQLNCDNETCSMYRYTNR 182 KI ++ EDN +Y + +N + N F +++ D C M +Y +R Sbjct: 43 KITVEYVPEDNYIYIDLENAIQFIKFISKHNYFCYEIDGDYHKCKMDKYIHR 94
>NU4M_ASTPE (P11992) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 460 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -2 Query: 230 FLSQLYF*LYTLLGSSSISISVHRACFIVTIQLLIEAIELDNY 102 + + +YF YTL+GS + +S+ A F +++ +I L NY Sbjct: 144 YQASIYFLFYTLIGSLPLLVSI-IAIFSYENTIILPSIHLTNY 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,089,397 Number of Sequences: 219361 Number of extensions: 399524 Number of successful extensions: 791 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)