| Clone Name | rbastl18h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RRN3_HUMAN (Q9NYV6) RNA polymerase I-specific transcription init... | 28 | 4.2 | 2 | Y1187_METJA (Q58588) Hypothetical protein MJ1187 | 28 | 5.5 | 3 | RELX_HORSE (P22969) Prorelaxin precursor (RXN) [Contains: Relaxi... | 27 | 9.4 |
|---|
>RRN3_HUMAN (Q9NYV6) RNA polymerase I-specific transcription initiation factor| RRN3 (Transcription initiation factor IA) (TIF-IA) Length = 651 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 246 EDDDLHIVRFSLMDPQVNGNIDFNWLLWERKYCFWLVTGFATL 118 E +D +++ L+DP + + NWLL R +L F L Sbjct: 67 ETNDFELLKNQLLDPDIKDDQIINWLLEFRSSIMYLTKDFEQL 109
>Y1187_METJA (Q58588) Hypothetical protein MJ1187| Length = 301 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 48 QKMCLTHD*SELGIDLIKFSDCWVEWR 128 Q +CL ++ GID+ KF++C + W+ Sbjct: 65 QAICLIKSLTKEGIDIKKFANCLIAWK 91
>RELX_HORSE (P22969) Prorelaxin precursor (RXN) [Contains: Relaxin B chain;| Relaxin A chain] Length = 182 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 331 DQKARRPFLRPSWQTLIEPPVIRNDNL 251 +QKA +PSW+ L++ P +++ NL Sbjct: 97 EQKATLSERQPSWRELLQQPALKDSNL 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,690,749 Number of Sequences: 219361 Number of extensions: 944799 Number of successful extensions: 1936 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1936 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)