Clone Name | rbastl18h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PURA_EHRCJ (Q3YRQ6) Adenylosuccinate synthetase (EC 6.3.4.4) (IM... | 27 | 9.5 |
---|
>PURA_EHRCJ (Q3YRQ6) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 431 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -3 Query: 214 VVINLVAGLIL*HCILVALFSNIKAGAIYEHSGHIRHLAISSPKISGRLKQQLET 50 V+++ V+GL++ ++ FS IK Y++ I +SP I +L+ ET Sbjct: 319 VILSGVSGLVMTKLDVLDQFSEIKICVKYKYENKIYDYLPASPYIQSKLEPVYET 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,316,948 Number of Sequences: 219361 Number of extensions: 677459 Number of successful extensions: 1784 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1784 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)