| Clone Name | rbastl18h03 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 93.6 bits (231), Expect = 1e-19 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADG 246 YG M SGHYTA+IKLL ++RWYNFDDSH+S INE++VKSGAAYVLFYRR ++A G Sbjct: 867 YGGMGSGHYTAHIKLLDDSRWYNFDDSHISHINEDDVKSGAAYVLFYRRKSDAGG 921
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 63.9 bits (154), Expect = 9e-11 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADGAASN 234 YG + GHYTAY+K +N+WY FDDS V+ E +G+AY+LFY RR + +G S+ Sbjct: 1061 YGGLGGGHYTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNGLGSS 1120 Query: 233 GTQSCVK 213 Q ++ Sbjct: 1121 KLQEIIQ 1127
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 63.2 bits (152), Expect = 1e-10 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG M GHYTA+ K + +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 884 YGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 63.2 bits (152), Expect = 1e-10 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG M GHYTA+ K + +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 884 YGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 61.6 bits (148), Expect = 4e-10 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADGAASN 234 YG+M GHYTAY K +WY FDDS VS +E+++ + AAYVLFY RR E +S Sbjct: 873 YGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECSSTSSL 932 Query: 233 GT 228 G+ Sbjct: 933 GS 934
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 61.6 bits (148), Expect = 4e-10 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG+M GHYTAY K +WY FDDS+VS +E+++ + AAYVLFY+R Sbjct: 874 YGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQR 922
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 YG + GHYTAY K RW+ FDD VS I+ VKS AAY+LFY Sbjct: 1060 YGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFY 1106
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 YG + GHYTAY K RW+ FDD VS I+ V+S AAY+LFY Sbjct: 1022 YGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFY 1068
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/49 (48%), Positives = 33/49 (67%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG M GHYT + +W+ FDD+ VS +NE +++S AAYVLFY+R Sbjct: 838 YGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQR 886
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 255 +G+ +SGHY AY + N WY FDD V+ ++E V++ AYVLFYR+ +E Sbjct: 666 HGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSE 717
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 55.1 bits (131), Expect = 4e-08 Identities = 23/49 (46%), Positives = 32/49 (65%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG M GHYT + +W+ DD+ VS +NE +++S AAYVLFY+R Sbjct: 716 YGGMRDGHYTTFACNKDSGQWHYLDDNSVSPVNENQIESKAAYVLFYQR 764
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 55.1 bits (131), Expect = 4e-08 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 258 YG + GHYTA+ K ++Y FDDS V+ + EE + AAY+LFYRR T Sbjct: 928 YGGLGGGHYTAFAKNPDNGQFYCFDDSRVTPVCPEETVTSAAYLLFYRRKT 978
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 54.7 bits (130), Expect = 5e-08 Identities = 22/52 (42%), Positives = 35/52 (67%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 255 +G+ SGHY AY + + +WY FDD +V+ ++E V++ YVLFYR+ +E Sbjct: 635 HGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSE 686
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 50.1 bits (118), Expect = 1e-06 Identities = 20/48 (41%), Positives = 33/48 (68%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYR 267 +G M++GHYTAY + ++ FDD+ + I+ E++ + +AYVLFYR Sbjct: 799 HGFMSNGHYTAYARDASSQTFFKFDDTAICEIDPEDIVTSSAYVLFYR 846
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVK 297 GS A GHY A IK + +WY+FDD HVS I +E++K Sbjct: 497 GSAAGGHYYACIKSFSDEQWYSFDDQHVSRITQEDIK 533
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/46 (47%), Positives = 33/46 (71%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 G++ GHY A+ K+ G +W+ F+DS VS+I++EEV AY+LFY Sbjct: 421 GTVNEGHYIAFCKISG-GQWFKFNDSMVSSISQEEVLKEQAYLLFY 465
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 G+ GHYTAY + G W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 551 GTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 596
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVK 297 GS A GHY A IK +++WY+F+D HVS I +E++K Sbjct: 497 GSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIK 533
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -3 Query: 401 MASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 + SGHYTAY + E RW++F+DS V+ +EE V AY+LFY Sbjct: 467 VGSGHYTAYA--VHEGRWFHFNDSTVTVTDEETVGKAKAYILFY 508
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 48.1 bits (113), Expect = 5e-06 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENR-------WYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG M GHYTA +L + W FDDS V+ ++E +V + AYVLFYRR Sbjct: 1211 YGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRR 1266
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 47.8 bits (112), Expect = 6e-06 Identities = 20/46 (43%), Positives = 30/46 (65%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 G+ GHYTAY K + W++F+DS V+ ++ V+S AY+LFY Sbjct: 303 GTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFY 348
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/44 (50%), Positives = 29/44 (65%) Frame = -3 Query: 401 MASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 + SGHYTAY E RW++F+DS V+ +EE V AY+LFY Sbjct: 468 VGSGHYTAYAT--HEGRWFHFNDSTVTLTDEETVVKAKAYILFY 509
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 46.6 bits (109), Expect = 1e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 YG + GHYT + + FDD+ VS + E +++S AAYVLFY+R Sbjct: 363 YGGLRDGHYTTFACNKDSGQSDYFDDNSVSPVTENQIESKAAYVLFYQR 411
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 45.1 bits (105), Expect = 4e-05 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 G+ GHYTAY + W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 299 GTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 344
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 45.1 bits (105), Expect = 4e-05 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 +G + +GHY Y K+ WY F+D++ + + + + AY+LFY R Sbjct: 413 HGGLNNGHYFTYSKIENTGEWYEFNDTYTGKVTDNHIVNQNAYILFYIR 461
>UBP4_YEAST (P32571) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Vacuole biogenesis protein SSV7) Length = 926 Score = 44.7 bits (104), Expect = 5e-05 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAI-NEEEVKSGAAYVLFYRRV 261 +G++ GHYTAY+K + W FDD+ + N+ + + AYVLFY RV Sbjct: 873 FGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFYHRV 923
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 44.3 bits (103), Expect = 7e-05 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 255 GS+ GHYTA + + W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 512 GSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 560
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 44.3 bits (103), Expect = 7e-05 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 10/59 (16%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENR----------WYNFDDSHVSAINEEEVKSGAAYVLFYRRV 261 G+M GHY AY++ G R WYN D++V ++ E+V AY+LFY R+ Sbjct: 901 GTMRGGHYVAYVR--GGQRVKETDSSSTAWYNVSDAYVRQVSLEKVLHSEAYILFYERI 957
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 44.3 bits (103), Expect = 7e-05 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 255 GS+ GHYTA + + W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 513 GSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 561
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 44.3 bits (103), Expect = 7e-05 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 17/66 (25%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVK-----------------SGAAYV 279 GS + GHY AYIK N W+ F+D +V++I +E+++ S AY+ Sbjct: 714 GSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGGPNGSYYSSAYTSSTNAYM 773 Query: 278 LFYRRV 261 L YR+V Sbjct: 774 LMYRQV 779
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 43.5 bits (101), Expect = 1e-04 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 22/71 (30%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGEN----------------------RWYNFDDSHVSAINEEEVKS 294 G+M SGHYTAY K N +W++ D+HV A+ +V + Sbjct: 752 GTMRSGHYTAYAKARTANSHLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLN 811 Query: 293 GAAYVLFYRRV 261 AY+LFY R+ Sbjct: 812 SQAYLLFYERI 822
>UBP5_YEAST (P39944) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) Length = 805 Score = 42.7 bits (99), Expect = 2e-04 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAIN-EEEVKSGAAYVLFYRRV 261 GS+ GHYT+Y+ + WY FDDS I E + +AYVLFY R+ Sbjct: 755 GSLYGGHYTSYVYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLFYERI 804
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 42.0 bits (97), Expect = 3e-04 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 G++ +GHY AY +N+W+ DD+ + + E EV + AY+LFY Sbjct: 389 GTLDTGHYIAYTYY--QNQWFLLDDTTIVEVKESEVLNSQAYLLFY 432
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 41.2 bits (95), Expect = 6e-04 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV----KSGAAYVLFYRRV 261 S GHYT + +G N W DD V IN+ +V AY+L+YRRV Sbjct: 738 SATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRV 789
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 41.2 bits (95), Expect = 6e-04 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV----KSGAAYVLFYRRV 261 S GHYT + +G N W DD V IN+ +V AY+L+YRRV Sbjct: 744 SATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRV 795
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 41.2 bits (95), Expect = 6e-04 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 13/62 (20%) Frame = -3 Query: 407 GSMASGHYTAYIKL-------LGENRWYNFDDSHVSAINEE------EVKSGAAYVLFYR 267 G++ SGHYT+ + +G ++WY FDD V A + ++ S YVLFY Sbjct: 1008 GTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYE 1067 Query: 266 RV 261 RV Sbjct: 1068 RV 1069
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 41.2 bits (95), Expect = 6e-04 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 8/51 (15%) Frame = -3 Query: 395 SGHYTAYIK-LLGENRWYNFDDSHVSAINEEEV-------KSGAAYVLFYR 267 SGHY A+I+ L EN+WY F+D VS + +E++ +S +A +L Y+ Sbjct: 445 SGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMYK 495
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 41.2 bits (95), Expect = 6e-04 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 12/61 (19%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENR------------WYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G+M+ GHY +YI+ + R WY+ DS V + EEV AY+LFY R Sbjct: 1023 GAMSRGHYVSYIRGGHKERRDSDTKEPNSSIWYHASDSQVRPASLEEVLRSEAYILFYER 1082 Query: 263 V 261 + Sbjct: 1083 I 1083
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 261 S +GHY Y+K +WY +DS V + N + V + AYVLFY R+ Sbjct: 377 SCHAGHYYCYVKA-SNGQWYQMNDSLVHSSNVKVVLNQQAYVLFYLRI 423
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 40.0 bits (92), Expect = 0.001 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTE 255 SGHYTAY W + +DS +S +EV AY+LFY +RVTE Sbjct: 634 SGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTE 681
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 258 SGHYTAY W + +DS + + EEV AY+LFY R T Sbjct: 610 SGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRRT 655
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/48 (33%), Positives = 29/48 (60%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G ++ GHY Y K +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1322 GILSGGHYITYAKN-PNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQ 1368
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G + GHY Y K +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1520 GILGGGHYVTYAKN-PNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQ 1566
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--KSG-----AAYVLFY 270 S GHY A+++ + +W FDD HV+ ++EE + SG +AYVL Y Sbjct: 404 SSQDGHYVAWMRSSEDGKWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLY 455
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/49 (30%), Positives = 33/49 (67%) Frame = -3 Query: 410 YGSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 +G++ SGHYT++I+ +++W++ DD+ ++ E++ Y+LFY + Sbjct: 658 HGTLESGHYTSFIRQQ-KDQWFSCDDAIITKATIEDLLYSEGYLLFYHK 705
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 38.5 bits (88), Expect = 0.004 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGAASNGT 228 SGHYTAY W + +DS ++ + EEV AY+LFY + T A + T Sbjct: 613 SGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARISET 668
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 38.5 bits (88), Expect = 0.004 Identities = 21/44 (47%), Positives = 24/44 (54%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 +GHY YIK WY +DS VS + V S AYVLFY R Sbjct: 369 AGHYFCYIKA-SNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIR 411
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/48 (31%), Positives = 32/48 (66%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G++ SGHYT++I+ +++W+ DD+ ++ + ++V Y+LFY + Sbjct: 473 GTLESGHYTSFIRQ-HKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/48 (31%), Positives = 32/48 (66%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G++ SGHYT++I+ +++W+ DD+ ++ + ++V Y+LFY + Sbjct: 473 GTLESGHYTSFIRQ-HKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 38.1 bits (87), Expect = 0.005 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSG--------AAYVLFYRR 264 S GHYTA + N+WY DD +++ + +++V G AY+L Y++ Sbjct: 856 SSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 37.7 bits (86), Expect = 0.007 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 8/58 (13%) Frame = -3 Query: 410 YGSMASGHYTAYIK--------LLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 261 +G M SGH+ Y + L N+W D V + +EV S +AY+LFY RV Sbjct: 445 HGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERV 502
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 37.7 bits (86), Expect = 0.007 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFY 270 SGHY +K G +WY DD+ V+ + V + AYVLFY Sbjct: 305 SGHYFCCVKA-GHGKWYKMDDTKVTRCDVTSVLNENAYVLFY 345
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 35.8 bits (81), Expect = 0.025 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 16/67 (23%) Frame = -3 Query: 407 GSMASGHYTAYIKL-----LGENR--WYNFDDSHVSAINEE---------EVKSGAAYVL 276 G++ +GHYT+ + +G NR W FDD ++ ++ E+ S YVL Sbjct: 643 GNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVL 702 Query: 275 FYRRVTE 255 FY R+ E Sbjct: 703 FYERMDE 709
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 35.4 bits (80), Expect = 0.032 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 16/63 (25%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSG----------------AAYVLF 273 S + GHYT ++ L ++ W+ DD+H+ + +V++ AY+LF Sbjct: 448 SASGGHYTVDVQQLDKSGWFRIDDTHIHRVPIHDVENSELSADPSLSKLGHGDRVAYLLF 507 Query: 272 YRR 264 Y R Sbjct: 508 YTR 510
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 35.4 bits (80), Expect = 0.032 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV 300 G +++GHY IK E++WY FDD V + +++V Sbjct: 459 GDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQV 494
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 35.0 bits (79), Expect = 0.042 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 ++ GHY +IK NRW F+D HV E+ Y+ FY+R Sbjct: 792 NVTCGHYVCHIKK--NNRWIKFNDRHVQL--SEQPPKELGYIYFYKR 834
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 35.0 bits (79), Expect = 0.042 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 10/59 (16%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVK----------SGAAYVLFYRRV 261 G SGHY YI+ + +W+ F+DS++ ++ E+++ AY+L Y ++ Sbjct: 312 GMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMKM 370
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.0 bits (79), Expect = 0.042 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 9/57 (15%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY--RRV 261 S +SGHY +++K ++ W FDD VS + E++ SG AYVL Y RRV Sbjct: 429 SSSSGHYVSWVKRK-QDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRV 484
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 35.0 bits (79), Expect = 0.042 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 9/57 (15%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY--RRV 261 S +SGHY +++K ++ W FDD VS + E++ SG AYVL Y RRV Sbjct: 429 SSSSGHYVSWVKRK-QDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRV 484
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 34.7 bits (78), Expect = 0.055 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEE 303 G GHY Y+ G+ +W FDD VS +EE Sbjct: 458 GDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEE 492
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 34.3 bits (77), Expect = 0.072 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 8/54 (14%) Frame = -3 Query: 404 SMASGHYTAYIKLLGEN-RWYNFDDSHVSAINEEEV-------KSGAAYVLFYR 267 S +SGHY A+I+ W+ F+D+ VS + E++ ++ +AY+L Y+ Sbjct: 409 SASSGHYQAWIRNSNNRAEWFRFNDAKVSIVPAEKIETLDGGGEADSAYILLYK 462
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 34.3 bits (77), Expect = 0.072 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 9/57 (15%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY--RRV 261 S +SGHY +++K + W FDD VS + E++ SG AYVL Y RRV Sbjct: 428 SSSSGHYVSWVKRK-HDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRV 483
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 33.9 bits (76), Expect = 0.094 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 22/69 (31%) Frame = -3 Query: 404 SMASGHYTAYIK--------LLG-------ENRWYNFDDSHVSAINEEEVKS-------G 291 S SGHY Y + LG EN+WY F+D+ VS + E V + Sbjct: 856 SSESGHYYCYAREGAARPAASLGTADRPEPENQWYLFNDTRVSFSSFESVSNVTSFFPKD 915 Query: 290 AAYVLFYRR 264 AYVLFYR+ Sbjct: 916 TAYVLFYRQ 924
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 33.9 bits (76), Expect = 0.094 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 392 GHYTAYIKLLGENRWYNFDDSHVSAINEEEVK 297 GHY AYI+ + +W+ F+DSHV + ++V+ Sbjct: 313 GHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQ 344
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 33.9 bits (76), Expect = 0.094 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 9/57 (15%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY--RRV 261 S +SGHY ++++ ++ W FDD VS + E++ SG AYVL Y RRV Sbjct: 428 SSSSGHYVSWVRRK-QDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRV 483
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 33.1 bits (74), Expect = 0.16 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -3 Query: 398 ASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSG---AAYVLFY 270 +SGHY + + + + W+ ++D VS I E V+S + Y+ FY Sbjct: 903 SSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFY 948
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 33.1 bits (74), Expect = 0.16 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV 300 G + GHY A IK ++ W+ FDD V+ +EV Sbjct: 475 GDLHGGHYYALIKPEKDSNWFKFDDDRVTRATIKEV 510
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 32.7 bits (73), Expect = 0.21 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINE--------EEVKSGAAYVLFYRRVTEA 252 G GHY + ++ W FDD +V+ +NE ++ AYVLFY E Sbjct: 369 GGPHRGHYVSIVRTKTYG-WVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADEE 427 Query: 251 DGAAS 237 D S Sbjct: 428 DDDVS 432
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 32.7 bits (73), Expect = 0.21 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV 300 G + +GHY A +K + WY +DD+ V+ EV Sbjct: 458 GDLHNGHYYALLKTEKDGPWYKYDDTRVTRATLREV 493
>UBP14_YEAST (P38237) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (Glucose-induced degradation protein 6) Length = 803 Score = 32.0 bits (71), Expect = 0.36 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRW----YNFDDSHVSAINEEEVKSGAAYVLFYRR 264 S+ SGHY +I+ L ++W YN D+ V+A + E++K Y+ FY R Sbjct: 754 SVHSGHYVVFIRKLVADKWKWVLYN-DEKLVAADSIEDMKKN-GYIYFYTR 802
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 31.6 bits (70), Expect = 0.47 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 21/70 (30%) Frame = -3 Query: 407 GSMASGHYTAYI---KLLG------------------ENRWYNFDDSHVSAINEEEVKSG 291 G++ GHY AY+ K L E RW D+ V + +EV Sbjct: 806 GTLNYGHYVAYVLSHKFLDLSAPSTNSKDFRSEAGIPERRWLYISDNIVRESSWDEVSKV 865 Query: 290 AAYVLFYRRV 261 AY+LFY RV Sbjct: 866 EAYMLFYERV 875
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 31.6 bits (70), Expect = 0.47 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 8/46 (17%) Frame = -3 Query: 407 GSMASGHYTAYIKLLG-----ENRWYNFDDSHVSAI---NEEEVKS 294 G + GHY +YI +NRWY FDD V+ ++EE+K+ Sbjct: 1873 GQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKT 1918
>UBP25_MOUSE (P57080) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (mUSP25) Length = 1055 Score = 31.6 bits (70), Expect = 0.47 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--------KSGAAYVLFY 270 G +GHY AYI E+RW ++D V+ + EE+ ++ +AY L Y Sbjct: 602 GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMY 655
>UBP25_HUMAN (Q9UHP3) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (USP on chromosome 21) Length = 1087 Score = 31.6 bits (70), Expect = 0.47 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--------KSGAAYVLFY 270 G +GHY AYI E+RW ++D V+ + EE+ ++ +AY L Y Sbjct: 601 GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMY 654
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 31.2 bits (69), Expect = 0.61 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 8/46 (17%) Frame = -3 Query: 407 GSMASGHYTAYIKLLG-----ENRWYNFDDSHVSAI---NEEEVKS 294 G + GHY +YI NRWY FDD V+ ++EE+K+ Sbjct: 1866 GQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKN 1911
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 30.8 bits (68), Expect = 0.80 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -3 Query: 395 SGHYTAYIKLLGENRWYNFDDSHVSAINE---EEVKSGAAYVLFY 270 SGHY + + + W+ ++D VS I+E +E + + Y+ FY Sbjct: 838 SGHYISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFY 882
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 30.4 bits (67), Expect = 1.0 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 261 S+ GHY A+I L E RW F+D V + G YV F++R+ Sbjct: 753 SVHCGHYVAHI--LKEGRWVIFNDDKVGISTDPPKDMG--YVYFFQRL 796
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 12/53 (22%) Frame = -3 Query: 392 GHYTAYIKLLGENRWYNFDDSHVSAINEEEVK------------SGAAYVLFY 270 GHY + +K N W FDD +V I E V+ + Y+LFY Sbjct: 314 GHYVSLVK--SHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGYILFY 364
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -3 Query: 404 SMASGHYTAYIK--LLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 261 S +GHY A+I+ + G+ +W F+D V + E YV + R+ Sbjct: 725 SAHAGHYVAFIRKEIDGKQQWVLFNDEKVLQVASLEEAKTTGYVYLFERL 774
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = -3 Query: 407 GSMASGHYTAYI----KLLGENRWYNFDDSHVSAI---NEEEVKS 294 G + GHY +YI G+ +WY FDD V+ +EE+K+ Sbjct: 1980 GQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKA 2024
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 5/36 (13%) Frame = -3 Query: 350 WYNFDDSHVSAINEEEVKSG-----AAYVLFYRRVT 258 W++ +DS V I E+++ +AY+LFYR+ T Sbjct: 448 WFDINDSKVHPIREKDITQQFQGKESAYMLFYRKAT 483
>SNUT2_PONPY (Q5R761) U4/U6.U5 tri-snRNP-associated protein 2 (Inactive| ubiquitin-specific peptidase 39) Length = 565 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G + G Y ++ G +WY D V+ I + + AY+ ++R Sbjct: 507 GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 554
>SNUT2_MOUSE (Q3TIX9) U4/U6.U5 tri-snRNP-associated protein 2 (Inactive| ubiquitin-specific peptidase 39) Length = 564 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G + G Y ++ G +WY D V+ I + + AY+ ++R Sbjct: 506 GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 553
>SNUT2_HUMAN (Q53GS9) U4/U6.U5 tri-snRNP-associated protein 2 (U4/U6.U5| tri-snRNP-associated 65 kDa protein) (65K) (Inactive ubiquitin-specific peptidase 39) (SAD1 homolog) Length = 565 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 264 G + G Y ++ G +WY D V+ I + + AY+ ++R Sbjct: 507 GKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 554
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 28.9 bits (63), Expect = 3.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 392 GHYTAYIKLLGENRWYNFDDSHVSAINEEEVKS 294 GHY + +K N W FDD V I E V++ Sbjct: 309 GHYVSLVK--SHNHWLFFDDESVEIIEESAVQT 339
>CA036_HUMAN (Q7Z3Z2) Protein C1orf36| Length = 195 Score = 28.9 bits (63), Expect = 3.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 133 KRNQRGSSKIAKVCNNSDYLWLDLRLRFTHDWVPL 237 ++ + S+ + KVC DY WL R T+D P+ Sbjct: 42 RQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPI 76
>NPW_PIG (Q8MI35) Neuropeptide W precursor (Preproprotein L8) (PPL8)| [Contains: Neuropeptide W-23 (NPW23) (L8); Neuropeptide W-30 (NPW30) (L8C)] Length = 152 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 41 LLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRR 169 LL++ L P P++ + + HT + ++HT G+L+ LRR Sbjct: 20 LLLLLLLPLPARAW-----YKHTASPRYHTVGRAAGLLMGLRR 57
>FENR_ANASO (P21890) Ferredoxin--NADP reductase (EC 1.18.1.2) (FNR)| Length = 440 Score = 28.5 bits (62), Expect = 4.0 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +1 Query: 4 FRMHSPSVFMQPTSNSIPHTFSVQVV*PQYPMVSHRNLAIPHTKRNQRGSSKIA--KVCN 177 F+ S VF PT+ +I + ++ + +YP AI ++N +G +V Sbjct: 320 FKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAE 379 Query: 178 NSDYLWLDLRLRFTHDWV 231 ++D LW ++ + TH ++ Sbjct: 380 HADELWQLIKNQKTHTYI 397
>UBP28_MOUSE (Q5I043) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEE--------VKSGAAYVLFY 270 G ++GHY AYI W ++D V+ + EE +++ +AY L Y Sbjct: 599 GQASAGHYWAYIYNQPRQTWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMY 652
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 404 SMASGHYTAYIKLLGENRWYNFDDSHVSAINE---EEVKSGAAYVLFY 270 ++ SGHY + W+ +DD V I E +E + Y+ FY Sbjct: 836 TLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFY 883
>UBP24_HUMAN (Q9UPU5) Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15)| (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) (Deubiquitinating enzyme 24) Length = 1870 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 30/81 (37%) Frame = -3 Query: 407 GSMASGHYTAYIKL---LGENRWYNFDDSHVSA--INEEEVKSGA--------------- 288 G +GHY ++IK G+ +WY F+D+ + +N+E ++ Sbjct: 1214 GQAHAGHYYSFIKDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNP 1273 Query: 287 ----------AYVLFYRRVTE 255 AY+LFY+RV++ Sbjct: 1274 YTDVRRRYWNAYMLFYQRVSD 1294
>UBP28_HUMAN (Q96RU2) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1077 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 8/54 (14%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEV--------KSGAAYVLFY 270 G +GHY AYI W ++D V+ + EEV ++ +AY L Y Sbjct: 594 GQANAGHYWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMY 647
>FENR_ANAVT (Q44549) Ferredoxin--NADP reductase (EC 1.18.1.2) (FNR)| Length = 440 Score = 28.1 bits (61), Expect = 5.2 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +1 Query: 4 FRMHSPSVFMQPTSNSIPHTFSVQVV*PQYPMVSHRNLAIPHTKRNQRGSSKIA--KVCN 177 F+ S VF PT+ +I + ++ + +YP AI ++N +G +V Sbjct: 320 FKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAE 379 Query: 178 NSDYLWLDLRLRFTHDWV 231 ++D LW ++ TH ++ Sbjct: 380 HADELWQLIKNEKTHTYI 397
>FENR_ANASP (P58558) Ferredoxin--NADP reductase (EC 1.18.1.2) (FNR)| Length = 440 Score = 28.1 bits (61), Expect = 5.2 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +1 Query: 4 FRMHSPSVFMQPTSNSIPHTFSVQVV*PQYPMVSHRNLAIPHTKRNQRGSSKIA--KVCN 177 F+ S VF PT+ +I + ++ + +YP AI ++N +G +V Sbjct: 320 FKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAE 379 Query: 178 NSDYLWLDLRLRFTHDWV 231 ++D LW ++ TH ++ Sbjct: 380 HADELWQLIKNEKTHTYI 397
>Y708_CHLMU (Q9PJW8) Hypothetical protein TC0708| Length = 621 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 362 GENRWYNFDD-SHVSAINEEEVKSGAAYVLFYRRVTEADGA 243 G N Y +DD + + + K+GA + +Y RVT+ +GA Sbjct: 569 GNNFEYEYDDLTPFAQATLADPKNGAPFAFYYLRVTQENGA 609
>RGYR2_SULSO (Q97ZF5) Reverse gyrase 2 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1166 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 44 LIVFLTPFPSKLYSRNILWSHTETLQFHTQK--GTKGVLLKLRRYATTQI 187 L+ P +LY+RNI+ ++TE L K G+ G++L + Y +++ Sbjct: 279 LLTGFEPSSIQLYARNIIDAYTENLDLSIVKELGSGGLILVSKEYGRSKL 328
>DISI_AGKCO (Q9IAB0) Zinc metalloproteinase contortrostatin precursor (EC| 3.4.24.-) [Contains: Disintegrin contortrostatin] Length = 483 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 114 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 28 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>DISB_AGKPI (Q805F4) Zinc metalloproteinase piscivostatin-beta precursor (EC| 3.4.24.-) [Contains: Disintegrin piscivostatin-beta] Length = 483 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 114 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 28 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = -3 Query: 392 GHYTAYIKLLGENRWYNFDDSHVSAINEEEV---KSGAAYVLFYRRVTEADGAASNGTQS 222 GHY W+ + D HV+ E+ V +S YV FY + + TQS Sbjct: 770 GHYINDAFDFKRQSWFTYSDLHVTRTQEDFVYRGRSSTGYVFFYMHNDIFEELLAKETQS 829
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 8/46 (17%) Frame = -3 Query: 407 GSMASGHYTAYI-----KLLGENRWYNFDDSHVSAI---NEEEVKS 294 G + GHY +YI K + WY FDD V+ ++EE+K+ Sbjct: 1875 GQASGGHYYSYIIQRNGKDDQTDHWYKFDDGDVTECKMDDDEEMKN 1920
>Y512_CHLPN (Q9Z840) Protein CPn_0512/CP0242/CPj0512/CpB0533| Length = 620 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 347 YNFDDS-HVSAINEEEVKSGAAYVLFYRRVTEADGA 243 Y +DD +S++ ++ A +V +Y RVT+AD A Sbjct: 573 YEYDDMVPLSSVTLKDPNGKAPFVFYYLRVTQADNA 608
>NPY2R_MACMU (Q9GK74) Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor)| Length = 381 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +2 Query: 23 LYSCSQLLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRRYATTQII 190 +YS S LLI+++ P +S +WS L+ H G RR TT+++ Sbjct: 218 VYSLSSLLILYVLPLGIISFSYTRIWS---KLKSHVSPGAANDHYHQRRQKTTKML 270
>LRRK1_MOUSE (Q3UHC2) Leucine-rich repeat serine/threonine-protein kinase 1 (EC| 2.7.11.1) Length = 2014 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 50 VFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRRY 172 +F+T FP++L+ N HTE +G G ++ RY Sbjct: 1222 LFMTDFPARLFLENSKLEHTEGENSILGQGGSGTVIYQARY 1262
>RPO1_ASFB7 (P42486) DNA-directed RNA polymerase subunit 1 (EC 2.7.7.6)| Length = 1450 Score = 27.3 bits (59), Expect = 8.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 329 DYHQNCTTCSHPRALC 376 D+H C TCSH R C Sbjct: 54 DHHYKCITCSHQRKQC 69
>ALGC_PSEPK (Q88C93) Phosphomannomutase/phosphoglucomutase (EC 5.4.2.8) (EC| 5.4.2.2) (PMM / PGM) Length = 463 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 407 GSMASGHYTAYIKLLGENRWYNFDDSHVSAINEEEVKS 294 GS+ +G + +I + + RWY FDD SA E+ S Sbjct: 319 GSLLAGEMSGHIFI--KERWYGFDDGIYSAARLLEILS 354
>MRP10_ARATH (Q9LZJ5) Multidrug resistance-associated protein 10 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 10) (ATP-energized glutathione S-conjugate pump 10) Length = 1539 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 370 SSWVRTGGTILMIVMFLPSMRKK*SQVQLTCCSTEELQ 257 +SW++ G I+ LP R K ++V CC +++Q Sbjct: 710 TSWIQNGTVQDNILFGLPMNRSKYNEVLKVCCLEKDMQ 747
>NPY2R_PANTR (Q5IS62) Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor)| Length = 381 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +2 Query: 23 LYSCSQLLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRRYATTQII 190 +YS S LLI+++ P +S +WS L+ H G RR TT+++ Sbjct: 218 VYSLSSLLILYVLPLGIISFSYTRIWS---KLKNHVSPGAANDHYHQRRQKTTKML 270
>NPY2R_HUMAN (P49146) Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor)| Length = 381 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +2 Query: 23 LYSCSQLLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRRYATTQII 190 +YS S LLI+++ P +S +WS L+ H G RR TT+++ Sbjct: 218 VYSLSSLLILYVLPLGIISFSYTRIWS---KLKNHVSPGAANDHYHQRRQKTTKML 270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,624,755 Number of Sequences: 219361 Number of extensions: 1238833 Number of successful extensions: 3962 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 3877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3947 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)