Clone Name | rbastl18h02 |
---|---|
Clone Library Name | barley_pub |
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -2 Query: 366 CCQTHCTCDQWSSRCCTIRGIC*QSKC 286 CC T CTC CC C Q C Sbjct: 78 CCPTKCTCCPKKCTCCPQPTCCVQPTC 104
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -2 Query: 375 GASCCQTHC---TCDQWSSRCCTIRGIC*QSKC 286 G+SCCQ+ C +C Q S CC + C QS C Sbjct: 142 GSSCCQSSCCKPSCSQ--SSCC--KPCCSQSSC 170
>PRKDC_CHICK (Q8QGX4) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4134 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 172 Y*SRRLHPM-LWQTMATSPCHVKDKLQNSYIC 264 Y ++ PM +W + T+ C DKLQ ++C Sbjct: 3175 YPDAKMDPMNIWDDIITNRCFFLDKLQEKFLC 3206
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 372 ASCCQTHCTCDQWSSRCCTIRGIC*QSKC 286 +SCC+ C CC +R +C + C Sbjct: 61 SSCCRPSCCESSCCRPCCCVRPVCGRVSC 89
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 375 GASCCQTHCTCDQWSSRCCTIR-GIC*QSK 289 GA+CC+ H +C C +R G C SK Sbjct: 288 GATCCEDHYSCCPHDYPICNVRQGTCSMSK 317
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 375 GASCCQTHC---TCDQWSSRCCTIRGIC*QSKCFLKQVSRANVAV 250 G+SCCQ+ C C Q S CC +C QS C ++N V Sbjct: 129 GSSCCQSSCCKPCCCQ--SSCCV--PVCCQSSCCKPCCCQSNCCV 169
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 372 ASCCQTHCTCDQWSSRCCTIRGIC*QSKC 286 +SCC+ C CC +R +C + C Sbjct: 138 SSCCRPSCCESSCCRPCCCVRPVCGRVSC 166
>PAND_METCA (Q605G8) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 126 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 224 GDVAIVCHSIGCNXXXXXXLRPQLVSSED*KQSVIHQH 111 GD+ I+C +G N RP LV ++ Q H Sbjct: 82 GDIVIICAYVGLNQAELAAYRPNLVYVDENNQITRTSH 119
>R1AB_IBVBC (Q91QT2) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL- Length = 6629 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 154 SCGLRVY*SRRLHPMLWQTMATSPCHVKDKLQNSYICSAN 273 +CG++ Y R L + AT+ H K + N C AN Sbjct: 1354 NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGAN 1393
>R1AB_IBVB (P27920) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL-P Length = 6629 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 154 SCGLRVY*SRRLHPMLWQTMATSPCHVKDKLQNSYICSAN 273 +CG++ Y R L + AT+ H K + N C AN Sbjct: 1354 NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGAN 1393
>VE6_HPV61 (Q80948) Protein E6| Length = 146 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 354 HCTCDQWSSRCCTIRGIC 301 H QW+ RCC RG C Sbjct: 123 HYIAGQWTGRCCQCRGPC 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,784,185 Number of Sequences: 219361 Number of extensions: 992750 Number of successful extensions: 2501 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2493 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)