Clone Name | rbastl18g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1356_MYCBO (P64806) Hypothetical protein Mb1356 | 31 | 0.71 | 2 | Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1 | 31 | 0.71 | 3 | MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structura... | 28 | 4.6 |
---|
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 287 PAASVDERRQWHAQSWFRYESFGPRAK 207 P A VD+RR WH W + GP K Sbjct: 70 PQAGVDDRRHWHTPCWANRATRGPTRK 96
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 287 PAASVDERRQWHAQSWFRYESFGPRAK 207 P A VD+RR WH W + GP K Sbjct: 70 PQAGVDDRRHWHTPCWANRATRGPTRK 96
>MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structural maintenance of| chromosome-related protein) Length = 1499 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 253 MRSHGLDMKVLDPERNSVESLYENLVRKRDYIY 155 +R HG+ + L+P N+++S EN R +D +Y Sbjct: 942 IRQHGMTLSQLEPIANTLQSDPENYERLKDDLY 974 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,709,644 Number of Sequences: 219361 Number of extensions: 643236 Number of successful extensions: 1725 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1725 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)