Clone Name | rbastl18f05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VD05_VARV (P33069) Protein D5 | 28 | 4.1 | 2 | TYCC_BREPA (O30409) Tyrocidine synthetase 3 (Tyrocidine syntheta... | 27 | 9.0 | 3 | TRA_STRLI (P22409) Protein tra | 27 | 9.0 | 4 | SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat... | 27 | 9.0 |
---|
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +3 Query: 159 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 338 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 339 C----IPVCGHEV 365 C +P+ G+++ Sbjct: 314 CKVKIVPLDGNKL 326
>TYCC_BREPA (O30409) Tyrocidine synthetase 3 (Tyrocidine synthetase III)| [Includes: ATP-dependent asparagine adenylase (AsnA) (Asparagine activase); ATP-dependent glutamine adenylase (GlnA) (Glutamine activase); ATP-dependent tyrosine adenylase (TyrA) (Ty Length = 6486 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = -2 Query: 375 AFLPLHGHTPE----YKSDHMKCVKHFTQRHLRPNTDADGGVMFIALRS 241 A+LP+ P+ Y D + TQ HL+PN G V+++ RS Sbjct: 540 AYLPIDPEYPQDRIQYLLDDSQTTLLLTQSHLQPNIRFAGSVLYLDDRS 588
>TRA_STRLI (P22409) Protein tra| Length = 621 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +1 Query: 4 GHTSLKVALSNSIITND*ILVQDVFPSIWEKRRDEKDCVGS 126 G + VA+++ + + LV+ + PS W + DE+ VG+ Sbjct: 147 GRRKVAVAVADELSAEERRLVERLDPSYWAQHADERGLVGT 187
>SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat protein 2)| (Syne-2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein) Length = 6885 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 112 DCVGSDASQE*QRIQEIWKKITTKSLPALN 201 D VGS S+E +R+ + W+K+ +K+ +N Sbjct: 641 DVVGSSISKELRRLNKRWRKLVSKTQLEMN 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,216,955 Number of Sequences: 219361 Number of extensions: 958823 Number of successful extensions: 1989 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1989 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)