Clone Name | rbastl18f02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TOP2_CANAL (P87078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoi... | 33 | 0.22 | 2 | LGRD_BREPA (Q70LM4) Linear gramicidin synthetase subunit D [Incl... | 29 | 2.4 | 3 | PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-depe... | 28 | 5.4 |
---|
>TOP2_CANAL (P87078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1461 Score = 32.7 bits (73), Expect = 0.22 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 1/98 (1%) Frame = -1 Query: 327 DRMRNNFVFFFIHSA*ETGSISNTE*AKKMWRRVM-TSNKQQGGREEAAVEEN*VQRDHT 151 D F F + E S+++ K RR T+ K Q ++ VE Sbjct: 1227 DEFLAEFDKFLLRDEQERESLASNGKKKSTKRRAKATATKDQPNNKKVKVEPK------- 1279 Query: 150 ERKNARLHTLIDYDLDNEVDACALPCPKEKQNALSFYS 37 E+K+ ++ + NE A + PKEK + LSF+S Sbjct: 1280 EKKSTSAKPIVKKEASNEPQASSSSKPKEKDDILSFFS 1317
>LGRD_BREPA (Q70LM4) Linear gramicidin synthetase subunit D [Includes:| ATP-dependent tryptophan adenylase (TrpA) (Tryptophan activase); ATP-dependent D-leucine adenylase (D-LeuA) (D-Leucine activase); Leucine racemase [ATP-hydrolyzing] (EC 5.1.1.-); ATP-d Length = 5085 Score = 29.3 bits (64), Expect = 2.4 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 7/100 (7%) Frame = +2 Query: 68 FGHGRAHASTSLSRS*SINVCSRAFFRSVWSLWT*FSSTAASSLPPCCLLLVMTRLHIFF 247 F H RA+ T+ R+ + AF SVW +W + A LP + LV +L + Sbjct: 1690 FWHQRAYDVTATDRA--SQIAGTAFDASVWEIWPYVTKGATLYLPEEEIRLVPEKLRDWL 1747 Query: 248 AYSVFEID----PVSH---ALWMKKNTKLFLMRSAGRRIH 346 S + P++ AL +T L M + G ++H Sbjct: 1748 VASNITVSFLPTPLTESMLALEWPGDTALRYMLTGGDKLH 1787
>PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 753 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 159 DHTERKNARLHTLIDYDLDNEVDACAL-PCPKEKQNALSFYSLL 31 D+T ++ R+HTLI +LD++ + PC K L Y L Sbjct: 671 DYTLKETQRVHTLIKQNLDSQASLMEISPCGHFKVKDLFHYQFL 714 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,371,162 Number of Sequences: 219361 Number of extensions: 937580 Number of successful extensions: 2272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2272 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)