Clone Name | rbastl18e10 |
---|---|
Clone Library Name | barley_pub |
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC| 3.4.21.-) (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 1 HFNQQISQQNKMLYSLKNCESIFQQDRRYIKIIVAIPIGQYSNE 132 H + ++ L L N S F R Y+ + +IP G+YSNE Sbjct: 433 HVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNE 476
>CJ006_MOUSE (Q6P9P0) Protein C10orf6 homolog| Length = 1278 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 18 FPTK*NAVQSKELRKHIPTRQAIHQNHRCNSNW 116 + TK V S+E +HIP+ + ++Q H +W Sbjct: 351 YHTKSKRVLSREAPRHIPSERKVYQTHCTEDSW 383
>ALR2_ECOLI (P29012) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 217 QAIICRISLTNLSKTLWHPHA 155 + + CR SL+N + TLWHP A Sbjct: 181 EGLECRRSLSNSAATLWHPEA 201
>ALR2_ECO57 (Q8X4I9) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 217 QAIICRISLTNLSKTLWHPHA 155 + + CR SL+N + TLWHP A Sbjct: 181 EGLECRRSLSNSAATLWHPEA 201
>LONH2_ARATH (P93655) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 940 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 1 HFNQQISQQNKMLYSLKNCESIFQQDRRYIKIIVAIPIGQYSNE 132 H Q I ++ L L+ S F R Y+ + +P G YSNE Sbjct: 374 HVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTILPWGNYSNE 417
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 82 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 192 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688
>ALR2_SALTY (P06191) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 217 QAIICRISLTNLSKTLWHPHA 155 + + C SL+N + TLWHP A Sbjct: 181 EGLQCAYSLSNSAATLWHPQA 201
>ALR2_SALTI (Q8Z688) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 217 QAIICRISLTNLSKTLWHPHA 155 + + C SL+N + TLWHP A Sbjct: 181 EGLQCAYSLSNSAATLWHPQA 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,367,707 Number of Sequences: 219361 Number of extensions: 592758 Number of successful extensions: 2404 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2404 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)