Clone Name | rbastl18e03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEM1_RAT (P13195) 5-aminolevulinate synthase, nonspecific, mitoc... | 28 | 6.8 | 2 | HEM1_CHICK (P07997) 5-aminolevulinate synthase, nonspecific, mit... | 28 | 8.8 | 3 | HEM1_MOUSE (Q8VC19) 5-aminolevulinate synthase, nonspecific, mit... | 28 | 8.8 |
---|
>HEM1_RAT (P13195) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 642 Score = 28.1 bits (61), Expect = 6.8 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 22 HLPYIFDAASPKIIFEYKIIYTLHQKPYGMATTNPLRRPMHAQMNSPR 165 H P + + K++ +K + L KP+ A N RRP+H ++ S R Sbjct: 580 HTPQMMNFFLEKLLLTWKRV-GLELKPHSSAECNFCRRPLHFEVMSER 626
>HEM1_CHICK (P07997) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 635 Score = 27.7 bits (60), Expect = 8.8 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 22 HLPYIFDAASPKIIFEYKIIYTLHQKPYGMATTNPLRRPMHAQMNSPRIR 171 H P + K++ +K + L KP+ A N RRP+H ++ S R R Sbjct: 573 HTPQMMSYFLEKLLATWKDV-GLELKPHSSAECNFCRRPLHFEVMSERER 621
>HEM1_MOUSE (Q8VC19) 5-aminolevulinate synthase, nonspecific, mitochondrial| precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-H) Length = 642 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 22 HLPYIFDAASPKIIFEYKIIYTLHQKPYGMATTNPLRRPMHAQMNSPR 165 H P + + K++ +K + L KP+ A N RRP+H ++ S R Sbjct: 580 HTPQMMNFFVEKLLVTWKRV-GLELKPHSSAECNFCRRPLHFEVMSER 626 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,040,599 Number of Sequences: 219361 Number of extensions: 495939 Number of successful extensions: 1148 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)