Clone Name | rbastl18e01 |
---|---|
Clone Library Name | barley_pub |
>RRMJ_BARHE (Q6G4Z3) Ribosomal RNA large subunit methyltransferase J (EC| 2.1.1.-) (rRNA (uridine-2'-O-)-methyltransferase) (23S rRNA m2U2552 methyltransferase) Length = 247 Score = 30.4 bits (67), Expect = 1.1 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 231 GGKVIVLGMGPGGGAQVSG-FMGSA--LPSRVLVD*AHKVLLPRGVL 100 G K+I LG PGG QVSG +GS+ PS V +D H LP V+ Sbjct: 77 GQKIIDLGAAPGGWCQVSGCIVGSSDEKPSVVGIDYLHVDPLPGVVM 123
>BAT3_HUMAN (P46379) Large proline-rich protein BAT3 (HLA-B-associated| transcript 3) (Protein G3) Length = 1132 Score = 25.0 bits (53), Expect(2) = 1.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 140 TRTLLGRAEPMNPDTWAPPPGP 205 T T G P P+ APPPGP Sbjct: 386 TMTGNGTRPPPTPNAEAPPPGP 407 Score = 23.5 bits (49), Expect(2) = 1.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 188 APPPGPIPSTITFPP 232 APPPGP P T P Sbjct: 427 APPPGPAPPPATSHP 441
>CLUS_MOUSE (Q06890) Clusterin precursor (Sulfated glycoprotein 2) (SGP-2)| (Clustrin) (Apolipoprotein J) (Apo-J) [Contains: Clusterin beta chain; Clusterin alpha chain] Length = 448 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/86 (19%), Positives = 34/86 (39%) Frame = +1 Query: 109 ARKQNFVSSVYKDPAWKGRAHEP*HLGPAPWPHSQHYYLPAIFHQXXXXXXFKHLHRPPP 288 AR + ++++D + H+P + P +PH + ++L H P Sbjct: 180 ARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSF 239 Query: 289 QHLV*KVLRSRGQSLGRLVVQVHLPA 366 ++ Q+ + VQ+H PA Sbjct: 240 HNMFQPFFEMIHQAQQAMDVQLHSPA 265
>DIAP1_MOUSE (O08808) Protein diaphanous homolog 1 (Diaphanous-related formin-1)| (DRF1) (mDIA1) (p140mDIA) Length = 1255 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 167 PMNPDTWAPPPGPIPSTITFPP 232 P+ P T PPP P+P PP Sbjct: 604 PLPPGTCIPPPPPLPGGACIPP 625
>RSMB_DROME (Q05856) Small nuclear ribonucleoprotein-associated protein B| (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 199 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 131 AQSTRTLLGRAEPMNPDTWAPPPGPIPSTITFPP 232 AQ +GR P P APPPG IP + P Sbjct: 136 AQQHMAPMGRGVPRAPMMGAPPPGMIPGGMPSMP 169
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 167 PMNPDTWAPPPGPIPSTITFPP 232 PM P +PPP P P T PP Sbjct: 285 PMPPSPPSPPPSPAPPTPPTPP 306
>CAC1F_HUMAN (O60840) Voltage-dependent L-type calcium channel alpha-1F subunit| (Voltage-gated calcium channel alpha subunit Cav1.4) Length = 1966 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 203 GQGAGP-RCQGSWARPFQAGSL 141 G+ +GP R QGSWA P Q G L Sbjct: 1815 GRNSGPNRAQGSWATPPQRGRL 1836
>MEI1_CAEEL (P34808) Meiotic spindle formation protein mei-1 (EC 3.6.4.3)| (Katanin ATPase-containing subunit) Length = 472 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 167 PMNPDTWAPPPGPIPSTITF 226 P +PD W+ P P+PS+ F Sbjct: 96 PADPDVWSKPSPPLPSSSKF 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,894,427 Number of Sequences: 219361 Number of extensions: 660181 Number of successful extensions: 2620 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2611 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)