Clone Name | rbastl18d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENV_HV1Z3 (P12491) Envelope polyprotein GP160 precursor [Contain... | 28 | 6.0 | 2 | DMXL1_MOUSE (Q6PNC0) Protein DmX-like 1 (X-like 1 protein) | 28 | 6.0 | 3 | WGRTX_GRASP (P60590) Omega-grammotoxin SIA (Omega-GrTx SIA) (Ome... | 28 | 7.8 |
---|
>ENV_HV1Z3 (P12491) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120)] Length = 460 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 7/59 (11%) Frame = +2 Query: 98 ITCGC----NNLNNKTHESDFVNITPKISHIYKDQE*AFHSKYHKFTV---NETTDSTL 253 +T C N+ NN T E+ N + K+ KD+ H+ ++K V N T +S++ Sbjct: 126 VTLNCIDVKNSTNNNTEEATITNCSFKVPTELKDKTETVHTLFYKLDVVPLNVTNNSSI 184
>DMXL1_MOUSE (Q6PNC0) Protein DmX-like 1 (X-like 1 protein)| Length = 3013 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -2 Query: 127 VIQIVAATCYSNCCGPITHVNCPNRCANFGNEFNTECEP 11 V ++ C N C PN C +G++ N CEP Sbjct: 249 VCNVLLTCCKDNVCRLWVETFLPNDCFLYGSDCNHWCEP 287
>WGRTX_GRASP (P60590) Omega-grammotoxin SIA (Omega-GrTx SIA) (Omega-GsTx SIA)| (Omega-GTX SIA) Length = 36 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 176 CVIFWV*C*QNQTRVFCYSNCCSHMLFKLLRPHNAC 69 CV FW C Q S+CC H+ K P N C Sbjct: 2 CVRFWGKCSQT-------SDCCPHLACKSKWPRNIC 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,260,352 Number of Sequences: 219361 Number of extensions: 782534 Number of successful extensions: 1795 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1795 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)