| Clone Name | rbastl18d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like p... | 28 | 4.8 | 2 | NIN_HUMAN (Q8N4C6) Ninein (hNinein) | 28 | 4.8 | 3 | YG4U_YEAST (P53308) Hypothetical 11.9 kDa protein in DIE2-SMI1 i... | 28 | 6.3 | 4 | YWV1_CAEEL (Q11075) Hypothetical protein B0403.1 | 28 | 6.3 |
|---|
>KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like protein RBKIN)| Length = 1805 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 57 IHEHKEQAEYLKQTTNKIEIMKAPKLT*KTCLEKKICTSLT 179 I E +E+ E L++ ++ E MKAP+L K +K+ LT Sbjct: 367 IRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELT 407
>NIN_HUMAN (Q8N4C6) Ninein (hNinein)| Length = 2090 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 45 VHHFIHEHKEQAEYLKQTTNKIEIMKAPKL 134 VHH I E K++ +YL+ T +E +KA ++ Sbjct: 1380 VHHVIEECKQENQYLEGNTQLLEKVKAHEI 1409
>YG4U_YEAST (P53308) Hypothetical 11.9 kDa protein in DIE2-SMI1 intergenic| region Length = 114 Score = 28.1 bits (61), Expect = 6.3 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 220 FLNMSSCCMLTNLG--VRLVQIFFSKHVFYVSFGAFIISILFVVCFRYSACSLCSC 59 FL +SS C+ T+ V FS F +FG F S L + C + +L SC Sbjct: 32 FLFISSVCLFTSSSFFADSVTCSFSTCSFSSTFGCFSSSFLSLSCLMSTLSALISC 87
>YWV1_CAEEL (Q11075) Hypothetical protein B0403.1| Length = 198 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 157 FSKHVFYVSFGAFIISILFVVCFRYSACSL 68 F KH+ YVS AF+ + CFR++ SL Sbjct: 23 FQKHIEYVSNSAFLKCRQLLRCFRFTNVSL 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,419,059 Number of Sequences: 219361 Number of extensions: 484246 Number of successful extensions: 1598 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1597 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)