Clone Name | rbastl18d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PER_LOXAL (Q25221) Period circadian protein (Fragment) | 30 | 3.1 | 2 | TMK1_ARATH (P43298) Putative receptor protein kinase TMK1 precur... | 29 | 5.3 | 3 | L2AM_DROLE (O96569) Alpha-methyldopa hypersensitive protein (EC ... | 28 | 6.9 |
---|
>PER_LOXAL (Q25221) Period circadian protein (Fragment)| Length = 109 Score = 29.6 bits (65), Expect = 3.1 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 153 PKYNHL*HLDN*TKTFNSRRKSFVV---PHE*RVDHGNSSSAESTRALMRHA*STG 311 P YN L + +N + FNS+ + V PHE + S+ A S R+ +RH +G Sbjct: 9 PSYNQLNYNENLQRFFNSKPITAPVDVDPHEVEQSYDASTDARSFRSPLRHFEGSG 64
>TMK1_ARATH (P43298) Putative receptor protein kinase TMK1 precursor (EC| 2.7.11.1) Length = 942 Score = 28.9 bits (63), Expect = 5.3 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 7 KLIHYQQIAQGTSGVHMYEMTHAKEMKLQPLQMLQPYTVGKHMVEGGEHL 156 KL+ Y+ + QGT H++E + E L+PL Q T+ + G E+L Sbjct: 659 KLLVYEYMPQGTLSRHLFEWS---EEGLKPLLWKQRLTLALDVARGVEYL 705
>L2AM_DROLE (O96569) Alpha-methyldopa hypersensitive protein (EC 4.1.1.-)| (Fragment) Length = 439 Score = 28.5 bits (62), Expect = 6.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 143 PSTMCFPTVYGCNICKG*SFISLAWVISYICT 48 P+++ +P++ G + G S I +W+ S CT Sbjct: 10 PTSVSYPSIVGEMLASGFSIIGFSWICSPACT 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,900,097 Number of Sequences: 219361 Number of extensions: 1194408 Number of successful extensions: 2064 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2064 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)