Clone Name | rbastl18c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GBLP_ORYSA (P49027) Guanine nucleotide-binding protein beta subu... | 35 | 0.052 | 2 | RNFD_BUCAP (Q8KA19) Electron transport complex protein rnfD | 28 | 6.3 | 3 | C5AR_MACMU (P79188) C5a anaphylatoxin chemotactic receptor (C5a-... | 28 | 6.3 |
---|
>GBLP_ORYSA (P49027) Guanine nucleotide-binding protein beta subunit-like| protein (GPB-LR) (RWD) Length = 334 Score = 35.0 bits (79), Expect = 0.052 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 237 TDGTIRIYKISGFSYS 190 TDGTIRIYKISGFSY+ Sbjct: 318 TDGTIRIYKISGFSYA 333
>RNFD_BUCAP (Q8KA19) Electron transport complex protein rnfD| Length = 349 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 213 KISGFSYSS*IMYLVLVASAPVKRLWYLLFFDCLEA*YLPWYL 85 K S F YSS + ++L S P W+++ F C A + YL Sbjct: 70 KNSLFDYSSFLTAVLLGLSTPCALPWWMIIFSCFFAIVISKYL 112
>C5AR_MACMU (P79188) C5a anaphylatoxin chemotactic receptor (C5a-R) (C5aR)| (CD88 antigen) (Fragment) Length = 340 Score = 28.1 bits (61), Expect = 6.3 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -1 Query: 200 SATLARLCILF*WPLLR*NGCGIFFFLTVLRRNICLGTYA-*FTICVLAAVMISWIMHRL 24 + +ARL + F WPLL C F L R T + V+A+ I W+ +++ Sbjct: 194 AVAIARLVLGFVWPLLTLTMCYTFLLLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQV 253 Query: 23 LVLAVQY 3 + + + Sbjct: 254 TGMMMSF 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,124,384 Number of Sequences: 219361 Number of extensions: 440614 Number of successful extensions: 908 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)