| Clone Name | rbastl18b07 |
|---|---|
| Clone Library Name | barley_pub |
>ZNF76_HUMAN (P36508) Zinc finger protein 76| Length = 570 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 157 KKPYQCCILHCGQ*MKSYTSSSFRARTIAHLAAVQHVHCRPSSTNT 294 +KPY C + CG+ Y+S + V H HC+P + +T Sbjct: 312 EKPYVCTVPGCGKRFTEYSS--------LYKHHVVHTHCKPYTCST 349
>NOS3_BOVIN (P29473) Nitric-oxide synthase, endothelial (EC 1.14.13.39)| (EC-NOS) (NOS type III) (NOSIII) (Endothelial NOS) (eNOS) (Constitutive NOS) (cNOS) Length = 1204 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 199 MKSYTSSSFRARTIAHLAAVQHVHCRPSSTNTYHLK 306 + Y SS R+ + AH +Q V +ST TYHL+ Sbjct: 132 INQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLR 167
>GP1D_CHLTR (P10555) Probable plasmid replicative DNA helicase (EC 3.6.1.-)| (dnaB-like protein) (Virulence plasmid protein pGP1-D) (Protein P-3) Length = 451 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -3 Query: 280 LGDSGHVEQQQDVLLFWPGRRRKCSSSFIVHNVECSIGK 164 L DSG +EQ DV+LF RK SSS N E ++GK Sbjct: 393 LRDSGQIEQDADVILF---INRKESSS----NCEITVGK 424
>DHMH_PARDE (P29894) Methylamine dehydrogenase heavy chain precursor (EC| 1.4.99.3) (MADH) Length = 417 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Frame = -2 Query: 335 WRR*RWQMITF-----RWYVLVELGRQWTC*TAARCAIVLARKEEE 213 WR WQ + + R Y+LV+ +W TA+R +VL K E Sbjct: 308 WRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRLLVVLDAKTGE 353
>SEF1_YEAST (P34228) Suppressor protein SEF1| Length = 1057 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = -3 Query: 295 TCWLSLGDSGHVEQQQDVLLFWPGRRRK----CSSSFI 194 TCW+ S H+ Q +L WP +K CS F+ Sbjct: 413 TCWIRTPRSTHISQALLILCIWPLPNQKVLDDCSYRFV 450
>PEPT_BACAN (Q81WU4) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 410 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +3 Query: 129 LTVILSYTGKETLPMLHSTL----WTMNEELHFLLLPGQ 233 L +TGK P +H T+NEEL+ +L P Q Sbjct: 80 LDTATDFTGKNVKPQIHENFDGNAITLNEELNIVLTPEQ 118
>CP52P_CANTR (P30612) Cytochrome P450 52C1 (EC 1.14.14.-) (CYPLIIC1)| (Alkane-inducible P450-ALK7) Length = 505 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 49 QCMNHEYTLDYRTDLVVGSRHSSLK 123 Q + H +T+DY TD ++G SLK Sbjct: 179 QTLAHLFTIDYSTDFLLGESCDSLK 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,791,663 Number of Sequences: 219361 Number of extensions: 842819 Number of successful extensions: 1586 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)